KEGG   Rhodopseudomonas palustris CGA009: RPA0391Help
Entry
RPA0391           CDS       T00153                                 

Definition
(GenBank) possible alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00730  Thiamine metabolism
rpa00790  Folate biosynthesis
rpa01100  Metabolic pathways
rpa02020  Two-component system
Module
rpa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RPA0391
   00790 Folate biosynthesis
    RPA0391
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA0391
Enzymes [BR:rpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RPA0391
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA0391
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rpa00537]
 Enzymes
  RPA0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: CAE25835
CyanoBase: RPA0391
CYORF: RPA0391
UniProt: Q6NCS8
Position
complement(429741..431498)
Genome map
AA seq 585 aa AA seqDB search
MMTKHIAATAFASLMFVSAASAQTIYPIDRAEILAGAKFDLKVEFAGEVAANTASLTING
ADAASVFGKAPELIAQEAGQPRSALLLRDVTLNKPGRYSIEAGDGATRRSVSWTVYDTGP
RRAKNVILFIGDGLSPAHRVAARLLSKGIQEGRAGGKLAIDDMPQMALVSTAGSDSIITD
SANAASAYATGHKAAVNAMGVYADRTPDPLDDPKVETLASVAKRRLGLSIGIVTNTEVED
ATPAAVIAHTRRRAAYDDIVAQFYAAQPDVLMGGGAAYFLPKSANGKRKDDIDYLAKFRD
AGYAVANNATDLDAASKTAPRKLLGLFAPGNMDGVLDRRFLKGGGVTKNPDQPDLTQQVA
VALDVLSKNDAGFFLMVESGLIDKYAHALDMERAVYDTIMLDNAVRQTRDWAKARGDDTL
ILVVADHNHPNALVGTVRDDLAEGDDVPLRERIGVYERAGFPNYPAPDADGYPERVDVSR
RIAIFSASLPDHYETLRPKLDGPNQPTEAGDKPGTFKANDKYKGVPGAVLRIGNLPAMMN
ASVHSGEDVILTATGPGSDRVRGSLENTDVFRVMAAALGLGAEAK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaagcatattgccgcgaccgcgtttgcgtcgctgatgttcgtttcggccgct
tcggcccagacgatttatccaatcgaccgcgccgagattctggccggcgccaagttcgac
ctcaaggtcgaattcgcgggcgaagtcgcggccaacacagcgagcctcaccatcaatggc
gctgacgccgcgagcgtgttcggcaaggcaccggagctgatcgcgcaagaagcggggcag
ccgcgatcggcgctgctgctccgcgacgtaacgctgaacaaacccggccgctacagcatc
gaagccggtgacggcgctacacgccgcagcgtgagctggacggtgtacgacaccgggcca
cgccgggccaagaacgtgatcctgtttatcggcgacggactgtcgccggcgcatcgggtg
gcggcacgactgctgtcgaaaggcattcaggaaggccgtgcgggcggcaagctggcgatc
gacgacatgccgcagatggcgctggtctcgaccgcgggcagcgactcgatcatcaccgac
tcggccaatgcggccagcgcctacgcgaccggccataaggccgccgtcaacgcgatgggg
gtctatgcggaccgcacccccgacccgctcgacgaccccaaggtggaaacgcttgcgtcg
gtcgcgaagcgacggctggggctgtcgatcggcatcgtcaccaacaccgaagtggaagac
gcgacgcccgccgcggtgatcgcccacacccgccgccgcgcggcttatgacgacatcgtc
gcgcagttctatgccgcgcagcccgacgtgctgatgggcggcggcgccgcttacttcctg
ccaaagagcgcgaacggcaagcgcaaggatgatatcgattatctggcgaagttccgcgac
gccggctacgcggtcgccaacaatgcgaccgacctcgacgcggcgagcaagaccgccccg
cgaaaactgctcggcctgttcgctcccggcaacatggacggcgtgctcgaccgccgtttc
ctgaaaggtggtggcgtcaccaagaaccccgaccagcctgatctgacccagcaggtcgcg
gtcgcgctcgacgtgctgtcgaagaacgatgcgggcttcttcctgatggtcgaatccggc
ctgatcgacaaatacgcccatgcgctcgacatggagcgagccgtctatgacaccatcatg
ctcgacaacgcggtgcgccagacccgcgactgggccaaggcccgcggcgacgacacgctg
atcctggtggtggccgatcacaaccatccgaacgcgctggtcggcaccgtgcgcgacgat
ctcgccgagggtgacgacgtgccgctgcgcgagcggatcggcgtgtacgaacgcgccggc
tttccgaactatccggcgcccgatgcggacggctatccggagcgggtcgatgtcagccgg
cgcatcgcgatcttctcggccagccttccggatcactacgagacgctgcggccgaagctc
gacgggccgaaccagccgaccgaggcgggcgacaagcccggcaccttcaaggccaacgac
aagtacaagggcgtgcccggcgcggtgctgcgcatcggcaatctgccggcgatgatgaat
gccagcgtgcactccggcgaggacgtgatcctgaccgctaccggccccggcagcgaccgc
gttcgcggctcgctggagaacaccgacgtgttccgggtgatggccgccgcgctgggcctc
ggcgccgaggccaagtag

DBGET integrated database retrieval system