KEGG   Rhodopseudomonas palustris CGA009: RPA1545Help
Entry
RPA1545           CDS       T00153                                 

Gene name
bchL
Definition
(GenBank) protochlorophyllide reductase iron-sulfur ATP-binding protein BchL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00860  Porphyrin and chlorophyll metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPA1545 (bchL)
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RPA1545 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_26 MipZ AAA_24 SRP54 AAA_25 NB-ARC CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: CAE26986
CyanoBase: RPA1545
CYORF: RPA1545
UniProt: Q6N9K0
Position
1716600..1717538
Genome map
AA seq 312 aa AA seqDB search
MNILTDPNKLKTSGCADVNASKCAEGDGEGSVQVQLDPNLNIGTAKVFSIYGKGGIGKST
TSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDVLESVNFHSEEVRPEDFVF
EGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFASP
LQHSERAMIVAANDFDSIFAANRIAAAIQAKSKNYAVRLAGVIANRSRETDQIDKFGERT
GIKRVAHLPDLDVIRKSRLKKMTLFEMDHTPEIEAVQNEYLRLATELWEAKEPPVQGKPL
KDRDIFDLLGFD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctgactgatcccaataagctcaagacctcgggctgcgccgacgtcaacgcg
tcgaaatgcgccgagggcgacggcgagggcagtgtccaggtccagctcgaccccaacctc
aacatcggcaccgccaaggtgttctcgatctacggcaagggcggcatcggcaagagcacg
acctcgtcgaacctgtcggtggcgttctccaagctgggcaagcgcgtgctgcagatcggc
tgcgatccgaagcacgactccaccttcacgctcaccaagaagctgatgccgacggtgatc
gacgtcctggagtcggtgaacttccactccgaggaagtgcgccccgaagacttcgtgttc
gagggctacaacggcgtgatgtgcgtcgaggcgggcggtccgccggccggcaccggctgc
ggcggctacgtcgtcggccagaccgtcaagctgctcaaggagcaccacctgctcgaagat
accgacgtggtgatcttcgacgtgctcggtgacgtggtgtgcggcggcttcgcctcgccg
ctgcagcattccgagcgggcgatgatcgtcgccgccaacgacttcgattcgatcttcgcc
gccaaccgcatcgccgcggcgatccaggcgaagtcgaagaattatgccgttcgtctggcg
ggagtgattgccaatcgcagtcgcgagaccgaccagatcgacaagttcggcgaacgcacc
ggcatcaagcgcgtcgcgcatctgccggatctggatgtcatccgaaagagccgtctgaaa
aagatgacgctttttgagatggatcacaccccagaaattgaagctgtgcaaaatgagtat
cttcggctcgcgacggaattgtgggaggcgaaggaacccccggtccagggcaagccgctg
aaggatcgcgacatctttgatctcttgggatttgattga

DBGET integrated database retrieval system