KEGG   Rhodopseudomonas palustris CGA009: RPA1811Help
Entry
RPA1811           CDS       T00153                                 

Definition
(GenBank) enoyl CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00071  Fatty acid degradation
rpa00280  Valine, leucine and isoleucine degradation
rpa00281  Geraniol degradation
rpa00310  Lysine degradation
rpa00360  Phenylalanine metabolism
rpa00362  Benzoate degradation
rpa00380  Tryptophan metabolism
rpa00410  beta-Alanine metabolism
rpa00627  Aminobenzoate degradation
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa00903  Limonene and pinene degradation
rpa00930  Caprolactam degradation
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPA1811
   00650 Butanoate metabolism
    RPA1811
  Lipid metabolism
   00071 Fatty acid degradation
    RPA1811
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPA1811
   00310 Lysine degradation
    RPA1811
   00360 Phenylalanine metabolism
    RPA1811
   00380 Tryptophan metabolism
    RPA1811
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPA1811
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPA1811
   00281 Geraniol degradation
    RPA1811
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA1811
   00627 Aminobenzoate degradation
    RPA1811
   00930 Caprolactam degradation
    RPA1811
Enzymes [BR:rpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPA1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAE27252
CyanoBase: RPA1811
CYORF: RPA1811
UniProt: Q6N8U2
Position
complement(2038105..2038884)
Genome map
AA seq 259 aa AA seqDB search
MSTFEFIIVERQNAVGIIKLNRPKMLNALSFGVFREIGAAVEDLEADDAIGCILITGSEK
AFAAGADIKEMQPKGFIDMFNEDFTSIGGDRLARCRKPTVAAVAGYALGGGCELAMMCDI
IIAADTAKFGQPEITLGTIPGIGGTQRLTRAIGKYKAMDLCLTGRMMDAQEAERSGLVSR
IVPADKLMEEALGAAEKIATMSRPTAAMAKSAVNRALETTLAEGLAVERDLFRSTFALED
RAEGMAAFIEKRKPNNQNR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcacattcgaattcatcatcgtcgagcgtcaaaacgcggtcggcatcatcaagctc
aaccgcccgaagatgctgaatgcgctgtcgttcggcgtgtttcgcgagatcggcgcagcg
gtcgaggatctcgaggccgacgatgcgatcggatgcatcctgatcaccggcagcgagaag
gcgttcgccgccggcgccgatatcaaggagatgcagccgaagggtttcatcgacatgttc
aacgaggacttcacttcgatcggcggtgaccggctcgcgcgctgccgcaagccgaccgtc
gccgcggtcgccggctacgcgctcggcggcggctgcgaattggcaatgatgtgcgacatc
attatcgccgccgacaccgccaagttcggtcaaccggaaatcacgctgggcaccattccg
ggcatcggcggcacccagcgtctcacccgcgctatcggcaagtacaaggcgatggacctg
tgcctcaccggacggatgatggacgcgcaggaagccgagcgctcgggtctggtcagccgc
atcgtgccggccgacaagctaatggaagaagcgctcggcgccgccgaaaagattgccacg
atgtcgcgccccaccgcagcgatggccaaaagcgcggtgaaccgggcgctggaaactacg
ctcgccgaaggtctcgccgtcgagcgcgacctgttccgatcgaccttcgcgctggaagac
cgcgccgagggcatggcggcgttcatcgaaaagcgcaagccgaacaaccagaaccgctga

DBGET integrated database retrieval system