KEGG   Rhodopseudomonas palustris CGA009: RPA2304Help
Entry
RPA2304           CDS       T00153                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00071  Fatty acid degradation
rpa00072  Synthesis and degradation of ketone bodies
rpa00280  Valine, leucine and isoleucine degradation
rpa00310  Lysine degradation
rpa00362  Benzoate degradation
rpa00380  Tryptophan metabolism
rpa00620  Pyruvate metabolism
rpa00630  Glyoxylate and dicarboxylate metabolism
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa00900  Terpenoid backbone biosynthesis
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
rpa01212  Fatty acid metabolism
rpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPA2304
   00630 Glyoxylate and dicarboxylate metabolism
    RPA2304
   00640 Propanoate metabolism
    RPA2304
   00650 Butanoate metabolism
    RPA2304
  Lipid metabolism
   00071 Fatty acid degradation
    RPA2304
   00072 Synthesis and degradation of ketone bodies
    RPA2304
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPA2304
   00310 Lysine degradation
    RPA2304
   00380 Tryptophan metabolism
    RPA2304
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPA2304
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA2304
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA2304
Enzymes [BR:rpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPA2304
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAE27745
CyanoBase: RPA2304
CYORF: RPA2304
UniProt: Q6N7F3
Position
2611555..2612742
Genome map
AA seq 395 aa AA seqDB search
MTHDPIVIVGSARTPMGGFQGELKDATASQLGAAAISAAVVRAGLKPDAIDEVVFGCVLP
AGQGQAPARQASLGAGLPLSAGCTTVNKMCGSGMKAAMFAHDLLIAGSATVAVAGGMESM
TNAPYLLDRARGGYRMGHGRVIDHMFLDGLEDAYDKGRLMGTFAEDCAQSYQFTRETQDN
FAITSLTRAQAAIKDGSFAREITPVTIKAGKSEVTVTTDEQPLKAKLEKIPTLKPAFREG
GTVTAANSSSISDGAAALVLMRRSEADKRGLKPLAAIVGHSTHAHEPALFATAPIGAIRK
LSERTGWNLADVDLFEVNEAFAVVALAAMHDLGLPHDKVNVHGGACALGHPIGASGARVL
VTLLAALEKHDLKRGIASLCIGGGEATAVAVERLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgatcctatcgttatcgtcggctccgcgcgcaccccgatgggcggctttcag
ggcgagctgaaggacgccaccgcatcccagctcggcgcggctgctatttcggccgcggtc
gtgcgcgccggcctgaagccggatgcgatcgacgaagtcgtgttcggctgcgtgctgccg
gccggccagggccaggccccggcgcgccaggcgtcgctcggcgccggcctgccgctctcg
gccggctgcaccacggtcaacaagatgtgcggctccggcatgaaggccgcgatgttcgcg
catgatctgttgatcgccggcagcgccaccgtcgcagtcgccggcggcatggagagcatg
accaacgcgccgtatctgctcgaccgcgcgcgcggcggctatcgcatgggccacggccgg
gtgatcgaccacatgttcctcgacggcctggaagacgcctacgacaaggggcggctgatg
gggaccttcgccgaggactgtgcgcaaagctatcagttcacccgcgagacccaggacaat
ttcgccatcacttcgctgacccgtgcccaggcggcgatcaaggacggctcgttcgcgcgc
gagatcacgccggtgacgatcaaggccggcaagtcggaagtcaccgtgaccaccgacgag
cagccgctgaaggccaagctcgaaaagatcccgacgctgaagccggcatttcgcgaaggc
ggcaccgtgacggcggcgaactcgtcgtcgatctcagacggcgccgcggcgctggtgctg
atgcgccgctcggaggccgacaagcgcggcctgaagccgctcgcggcgatcgtcggccat
tccactcacgcgcatgagccggcgctgttcgccaccgcgccgatcggcgcgatccgcaag
ctcagcgaacgcaccggctggaatctcgccgacgtcgatctgttcgaagtcaacgaggcg
ttcgcggtggtggcgttggcggcgatgcacgatctcggcctgccgcacgacaaggtcaac
gtccatggcggcgcctgcgcgctcggccatccgatcggcgcctccggtgcacgcgtgctg
gtgacgctgctggcggcgctggagaagcacgacctcaagcgcggcatcgcctcgctgtgc
atcggcggcggcgaagccaccgctgtcgcggtcgagcggctgtcgtga

DBGET integrated database retrieval system