KEGG   Rhodopseudomonas palustris CGA009: RPA2365Help
Entry
RPA2365           CDS       T00153                                 

Definition
(GenBank) putative L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00260  Glycine, serine and threonine metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPA2365
Enzymes [BR:rpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RPA2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CAE27806
CyanoBase: RPA2365
CYORF: RPA2365
UniProt: Q6N793
Position
complement(2680655..2681755)
Genome map
AA seq 366 aa AA seqDB search
MIYAPAPDDPRLPPVRINLLSDTQTQPSAAMREAMARAPVGDEQIGADPTVNALCARVAD
LLGKEAAVFMASGTICNIAATLAHCRAGDEILAHETSHVVSLEGCTHAALGGFQIHPLPG
AGGQFSAETLRSALHRPDRHQARQSLVCVEQTTNLGGGTVWNALTLRQIAELARANGLAT
HMDGARLMNASVASGISPRQIAAGWDSVWIDFSKGLGAPLGAVLAGSRDFIDEVWLWKQR
LGGSLRQAGICAAACLYALDHNVGRLAEDHANARLLAAGLSQIDGVSAAPPETNLVYFDV
SGAAWSKQAIVDALRARGVLISILSDRLRACTHLDVTPAMIQEALAVIRNVVEGDTTARI
GRSAQI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgatctacgcccccgcccctgacgatccgcgactgccgccggtgcggatcaatttgctg
tcggacacccagactcagcccagtgcggcgatgcgggaggcgatggcgcgggcgccggtg
ggagacgaacagatcggtgccgatccgaccgtgaacgcgctgtgcgcccgtgtcgccgat
ctgctcggcaaggaggcggcggtgttcatggcgtccggcacgatctgcaacattgcggcg
acgttggcgcattgccgagccggcgacgaaattctcgcgcacgagacgtcccatgtcgtc
tcgctggagggctgcacacacgcggctctcggcggctttcagatccacccgctgccgggc
gcaggcggtcagttctccgctgaaacgctgcgatcggcgctgcatcggccagaccggcat
caggcgaggcagagcctggtgtgcgtcgagcagaccaccaatctcggcggcggcacggtg
tggaacgctttgacgctccggcagatcgcggaattggctcgcgccaatggattagccacc
catatggacggtgctcgcctgatgaacgccagcgtcgccagcggcatctcgccccggcag
atcgccgccggctgggactcggtgtggatcgacttcagcaagggcctcggcgcgccactc
ggtgccgtgcttgcgggatcgcgcgatttcatcgacgaggtctggctgtggaagcagcgg
ctcggcgggtcgctgcgtcaggccggcatttgcgccgccgcctgcctgtatgcgctcgac
cacaatgtcgggcgcctcgctgaggatcacgccaatgcccgattgctcgcggcaggcttg
tcgcagatcgacggcgtgagcgctgcaccgccggagaccaacctggtctatttcgacgtc
tccggcgccgcgtggtcaaagcaggcaattgtcgacgcgctgcgggcccgtggtgtgctg
atctcgatcctcagcgaccggctacgcgcctgcacgcatctcgacgtcacgcccgcgatg
atccaagaggcgctcgcagtgatccgcaacgtggtcgaaggcgatacgacggcccggatc
ggccgcagcgcacagatctga

DBGET integrated database retrieval system