KEGG   Rhodopseudomonas palustris CGA009: RPA3067Help
Entry
RPA3067           CDS       T00153                                 

Definition
(GenBank) putative NAD-dependent alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00010  Glycolysis / Gluconeogenesis
rpa00071  Fatty acid degradation
rpa00350  Tyrosine metabolism
rpa00625  Chloroalkane and chloroalkene degradation
rpa00626  Naphthalene degradation
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPA3067
  Lipid metabolism
   00071 Fatty acid degradation
    RPA3067
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPA3067
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPA3067
   00626 Naphthalene degradation
    RPA3067
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPA3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_2 DapB_N
Motif
Other DBs
NCBI-ProteinID: CAE28508
CyanoBase: RPA3067
CYORF: RPA3067
UniProt: Q6N5B3
Position
3471844..3472902
Genome map
AA seq 352 aa AA seqDB search
MTQMRRQSLVKFDAPLCETIIDAPKPQGREVLVKIERCGLCHSDLHIQDGYADLGGGKKL
DTTRGMTLPFTLGHEIAGVVAEVGPDAPQDLIGTKKAVFPWIGCGKCRDCLAGDENLCAK
NRFLGVSIDGGFATHVLVPDAKYLLDYDPLPTNVAATLMCSGITAYGALKRLVDRPRQRN
LLLIGLGGVGMMGLSLAQAMFKQPIAVADLSPAAREAALKNGAAVAYDPSEPDVAKRIFK
ETDGGFDGVVDFAGNDKSMNFAVSTVARGGKIVVSGLMGGQFSLPMVQWIYKRMTVEGFM
VGTLEETKELLALARAGKVKPTPMKEEPMQDAQKWIDQLRAGKVVGRIMLAN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatgcgtcgccagtctctggtgaaattcgacgccccgctttgtgagaccatc
atcgatgcgccgaagccgcaggggcgcgaagtgctggtgaagatcgagcgctgcggcctg
tgccactccgacctgcacattcaggacggctacgccgatctcggcggcggcaagaagctc
gataccacgcgcggcatgacgctgccgttcaccctgggtcatgagatcgccggcgtcgtc
gccgaagtcggtcccgacgctccgcaggatctgatcgggaccaagaaagcggtgtttcct
tggatcggctgcggcaaatgccgtgattgcctcgcgggcgacgagaacctgtgcgccaag
aaccgcttcctcggcgtctcgatcgacggcggcttcgcgacccacgtactggtgccggac
gccaagtatctgctcgactacgatccgctgccgaccaacgtcgctgcgacgttgatgtgc
tctggtatcaccgcctatggcgccttgaagcgtctggtggaccggcctcgtcagcgcaat
ctgctgctgatcggtctaggcggcgtcggcatgatgggtctctcgcttgctcaggcgatg
ttcaagcagccgatcgcggtggccgatctcagccccgcggcgcgcgaagcggcgctgaag
aacggcgcggccgtcgcttacgatccatcggagcccgacgttgccaagcgcatcttcaag
gagaccgatggcggcttcgatggcgtggtggatttcgccggcaacgataagtcgatgaac
ttcgccgtcagcacggttgcgcgtggtggcaagatcgtggtgtcgggtctgatgggcggc
cagttcagcctgccgatggtgcaatggatctacaagcgcatgaccgtcgaaggcttcatg
gtcggcacgctcgaagagaccaaggagctgctcgcgctcgcgcgtgccggcaaggtcaag
ccgactccgatgaaggaagagccgatgcaggatgcgcaaaagtggatcgatcagctgcgt
gccggcaaggtcgttggccgcatcatgctggcgaactaa

DBGET integrated database retrieval system