KEGG   Rhodopseudomonas palustris CGA009: RPA3069Help
Entry
RPA3069           CDS       T00153                                 

Gene name
kguA
Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00230  Purine metabolism
rpa01100  Metabolic pathways
Module
rpa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPA3069 (kguA)
Enzymes [BR:rpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RPA3069 (kguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 TsaE cobW MMR_HSR1 AAA_22 DUF99
Motif
Other DBs
NCBI-ProteinID: CAE28510
CyanoBase: RPA3069
CYORF: RPA3069
UniProt: P60556
Position
complement(3474243..3474905)
Genome map
AA seq 220 aa AA seqDB search
MSDGTAGSYSGVERRGLMFVLSSPSGAGKTTLSRMLVEQMPGLQMSVSATTRPMRPGEVD
GRDYYFVDRPKFDEMVGAGEFLEWANVFDNRYGTPRAPVEAALAVGRDVLFDIDWQGTQQ
LRSRAGSDVVSVFILPPSVQALEHRLHTRAQDSHEVIRGRMKKAGDEMSHFDAYDYIVVN
DNIGVAFESVRSILRAEQLKRERQVGLDAFVRGMRQQLEG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggaacggccggcagctacagcggtgtcgagcggcgcgggctgatgttcgtg
ctgtcgtcgccctccggcgccggcaagacgacgctgtcgcggatgctggtcgagcagatg
ccagggctgcagatgtcggtgtctgcaacgacacggccgatgcggcctggcgaggtcgac
ggccgcgactattactttgtcgatcggccgaaattcgacgagatggtcggagccggggag
ttcctcgaatgggccaacgtgttcgacaatcgctatggcacgccgcgtgccccggtcgaa
gccgcgctcgcagtcggccgcgatgtgttgtttgacatcgactggcagggcacacagcag
ctccgcagtcgcgctggaagcgacgtcgtcagcgtcttcatcctgccgccgtccgtgcag
gcgctggagcatcggctgcatacccgcgcgcaggattcccacgaggtgatccgcggtcgg
atgaagaaagccggcgacgagatgagccacttcgacgcctacgattacatcgtggtcaac
gacaatatcggcgttgccttcgagtccgtgcgctcgatcctgcgcgccgagcagctcaag
cgcgagcgtcaggtcggattggatgccttcgtccgcgggatgcgtcagcagctcgaaggc
tga

DBGET integrated database retrieval system