KEGG   Rhodopseudomonas palustris CGA009: RPA3715Help
Entry
RPA3715           CDS       T00153                                 

Gene name
pimB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00071  Fatty acid degradation
rpa00072  Synthesis and degradation of ketone bodies
rpa00280  Valine, leucine and isoleucine degradation
rpa00310  Lysine degradation
rpa00362  Benzoate degradation
rpa00380  Tryptophan metabolism
rpa00620  Pyruvate metabolism
rpa00630  Glyoxylate and dicarboxylate metabolism
rpa00640  Propanoate metabolism
rpa00650  Butanoate metabolism
rpa00900  Terpenoid backbone biosynthesis
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01120  Microbial metabolism in diverse environments
rpa01130  Biosynthesis of antibiotics
rpa01200  Carbon metabolism
rpa01212  Fatty acid metabolism
rpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPA3715 (pimB)
   00630 Glyoxylate and dicarboxylate metabolism
    RPA3715 (pimB)
   00640 Propanoate metabolism
    RPA3715 (pimB)
   00650 Butanoate metabolism
    RPA3715 (pimB)
  Lipid metabolism
   00071 Fatty acid degradation
    RPA3715 (pimB)
   00072 Synthesis and degradation of ketone bodies
    RPA3715 (pimB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPA3715 (pimB)
   00310 Lysine degradation
    RPA3715 (pimB)
   00380 Tryptophan metabolism
    RPA3715 (pimB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPA3715 (pimB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPA3715 (pimB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPA3715 (pimB)
Enzymes [BR:rpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPA3715 (pimB)
Exosome [BR:rpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPA3715 (pimB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAE29156
CyanoBase: RPA3715
CYORF: RPA3715
UniProt: Q6N3H9
Position
complement(4195279..4196466)
Genome map
AA seq 395 aa AA seqDB search
MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ
GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI
SLVQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRTAA
AQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRGEG
FTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAVPR
LLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGARLA
GHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccgttatcgtttcaaccgcgcgcacgccgatcggcaaggcgtatcgcggc
gccctcaacgccaccgagggtgccacactgctcggccacgccatcgagcacgcggtgaag
cgcgccggtatcgacccgaaggaggtcgaggacgtggtgatgggcgcggcgatgcagcag
ggcgccaccggcggcaacatcgcccgcaaggcgctgctgcgcgccggcctgccggtgact
accgccggcaccaccatcgatcggcagtgcgcctccggcctgcaggcgatcgcgctcgcc
gctcgctcggtgctgttcgacggcgtcgagatcgcggtcggcggtggcggcgagtcgatc
tcgctcgtccagaacgacaagatgaacaccttccacgccgtcgatccggcgctcgaggcg
atcaagggcgacgtctacatggcgatgctcgacaccgccgaaaccgtggcgaagcgctac
ggcatctcgcgcgagcgccaggacgagtattcgctggaaagccagcgccgcaccgcggct
gcgcagcagggcggcaagttcaacgacgagatcgcgccgatctcgaccaagatgggcgtc
gtcgacaaggccaccggcgcggtgtcgttcaaggatatcacgctgtcgcaggacgaaggc
ccgcggccggaaaccaccgctgaaggtctcgccggtcttaaggccgtgcgtggtgaaggc
ttcaccatcactgccggcaatgccagccagctgtcggacggcgcctcggccacggtgatc
atgagcgacaagacggcggccgcgaagggcctcaagccgctcggcatcttccgcggcatg
gtctcctacggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgc
ctgttgaagcgccatggtctcagcgtcgacgacatcggtctgtgggagctgaacgaagcc
ttcgccgtgcaggtgctgtactgccgcgacaagctcggcatcgatccggagaagctcaat
gtcaacggcggcgcgatctcggtcggccacccctacggcatgtcgggtgcacgcctcgcc
ggccacgcgctgatcgaaggccgtcgccgcaaggcgaagtacgcggtggtcacgatgtgc
gtcggcggcggcatgggctccgccggcctgttcgagatcgtgcactga

DBGET integrated database retrieval system