KEGG   Rhodopseudomonas palustris CGA009: RPA4147Help
Entry
RPA4147           CDS       T00153                                 

Definition
(GenBank) putative nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00240  Pyrimidine metabolism
rpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RPA4147
Enzymes [BR:rpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RPA4147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_transf_3 Glycos_trans_3N DUF2254 EutC HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CAE29588
CyanoBase: RPA4147
CYORF: RPA4147
UniProt: Q6N2A3
Position
4688895..4690361
Genome map
AA seq 488 aa AA seqDB search
MISRRSRALRPEVFRGFSRVELRINSKVLLATLMITDDDAMIGPDEVGLSEPAFRRFNEP
VGSAVSVTPARSPASLDAVRAKIQGHTLSAAEITAIVDDLAHFRYSDMEIAAFLISAARF
TTTDELLALVGAMASVGTKLTWDTPIVVDKHCIGGIPGNRTTMIVVPIVAAHGLMIPKTS
SRAITSPAGTADTMELLARVDLDVEQMKQVVHACGGCLVWGGHVNLSPADDILISVERPL
SLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKVTNANEAMRLRKLFEFVGDHFGISV
EVVTTDGRQPIGRGIGPVLEARDVMAVLGNEPGAPADLREKSLRLAAHLLEYDPKLRGGT
GYARAKELLDSGAALKKMQQIIDAQGPSPCPAELGSYAADVLAAADGVVNGIDCLRINRL
ARSAGAPVAKGAGIDLFKKIGDRVEKGEPLYRVYASDRSEFDLALAAAQAESGFAINHHT
PADVDLVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccgccgctcgcgcgccctgcgccccgaggtgtttcgcggcttcagccgcgtc
gaactgcgcatcaactccaaggtgctgctggcgacgctgatgatcaccgacgacgacgcg
atgatcggccccgacgaagtcggcctgtccgagccggcgttccgccgcttcaatgagccg
gtcggcagtgccgtgtcggtgacgccggcgcggtcgcccgcaagcctcgacgcggtacgc
gccaaaatccagggccacaccctgtcggctgcggagatcaccgcgatcgtcgatgacctc
gcgcacttccgttactccgacatggaaatcgcggcgttcctgatcagcgccgcgcgcttc
accacgaccgacgaactgctggcgctggtcggcgcgatggcctcggtcggtaccaaactg
acatgggacacgccgatcgtcgtcgacaagcactgcatcggcggcattcccggcaaccgc
accaccatgatcgtggtgccgatcgtcgccgcgcacggactgatgattccgaagacctcg
tcgcgcgccatcacctcgccggccggcaccgccgacaccatggaactgctggcgcgggtc
gatctcgacgtcgagcagatgaaacaggtggtgcacgcctgcggcggctgtttggtgtgg
ggcggccacgtcaacctgtcgccggccgatgacatcctgatctcggtcgagcgaccgctc
agcctcgacacgccggagcagatggtcgcctcgatcatgtcgaagaagctcgccgccggc
tcaacccgattgctgatcgacttcccggtcggcccgtccgccaaagtcaccaacgccaac
gaggcgatgcggctgcgcaaactgttcgagttcgtcggcgatcatttcgggatcagcgtc
gaagtggtgaccaccgacggccggcagccgatcggccgcggcatcggcccggttctggaa
gcgcgcgacgtcatggcggtgctcggcaacgagcccggcgcacccgctgacttgcgcgaa
aaatcgctgcggctcgctgcgcatctgcttgaatacgacccgaagctccgcggcggcacc
ggctatgcccgcgccaaggagttgctcgacagcggggctgcgctgaagaagatgcagcag
atcattgacgcgcaggggccttcgccgtgtccggccgagctcggcagctacgccgccgat
gtactcgctgcggccgatggcgtggtcaacggcatcgactgtctgcgcatcaaccggctc
gcccgcagcgccggcgcgccggtcgccaagggcgccggcatcgatctgttcaagaagatc
ggcgaccgcgtcgaaaagggcgagccactgtatcgggtctatgcgtccgaccgctccgaa
tttgatctcgcgctggcagccgcacaggcagagtccgggttcgcgatcaatcatcacacg
cccgccgacgtggatctggtgtcgtga

DBGET integrated database retrieval system