KEGG   Rhodopseudomonas palustris CGA009: RPA4531Help
Entry
RPA4531           CDS       T00153                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00340  Histidine metabolism
rpa01100  Metabolic pathways
rpa01110  Biosynthesis of secondary metabolites
rpa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RPA4531 (hisD)
Enzymes [BR:rpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RPA4531 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAE29971
CyanoBase: RPA4531
CYORF: RPA4531
UniProt: P60861
Position
complement(5111807..5113102)
Genome map
AA seq 431 aa AA seqDB search
MPLRLDNASPDFASKFKAFLAMKREVAADIEAATRAIVDDVAHRGDAALLEATEKFDRLT
LDAAGMRVGEAEVEAAVKACDSETVDALKLARDRIEFFHRRQLPKDDRFTDPLGVELGWR
WSAIEAVGLYVPGGTAAYPSSVLMNAIPAKVAGVERVVMVVPSPGGTLNPLVLAAAQLAG
ATEIYRIGGAQAVAALAYGTATIAPVAKIVGPGNAYVAAAKRLVFGRVGIDMIAGPSEVV
VVADKTANPDWIAADLLAQAEHDANAQSILITDSAVLAADVERALAAQLTTLPRVKIARA
SWDEFGAIIKVAKLEDAVPLANAIAAEHLEIMTADPEAFADKIRNAGAIFLGGHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILKCGPEQLAVLGPAAMALGKAEGLDAH
ARSVGLRLNQR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccccttcgtctcgataacgccagtcccgatttcgcttccaaattcaaagccttcctg
gcgatgaagcgggaggttgcggcggatatcgaggccgccacccgggccatcgtcgacgac
gtcgcgcatcgcggcgacgctgcgctgctggaagcgaccgaaaagttcgaccggctgacg
ctggatgccgccggcatgcgggtcggcgaggccgaggtcgaagccgccgtgaaggcgtgc
gattccgagacggtcgacgcgctgaagctggcgcgcgaccgcatcgaatttttccatcgc
cggcaattgccgaaggacgatcgcttcaccgatccgctcggcgtcgagctcggctggcgc
tggagcgcgatcgaggcggtcggcctgtacgtgcccggcggcaccgcggcgtatccgtcg
tcggtgctgatgaatgcgattccagccaaggtcgccggtgtcgagcgcgtggtgatggtg
gtgccgtcgcccggcggcacgctcaatccgctggtgctggccgcggcgcagctcgctggc
gccaccgagatctaccgtatcggcggcgcacaggcggtggctgcgttggcctacggcacc
gcgacgattgcgccggttgccaagatcgtcggccccggcaacgcttatgtcgctgcagcc
aagcgcctggtgttcggccgcgtcggcatcgacatgatcgctggcccgtccgaggtcgtc
gtcgtcgcagacaagaccgccaatccggattggattgcggccgatttgttggcgcaggcc
gagcacgacgccaatgcgcaatcgattctgattaccgatagcgcggtgctcgccgccgac
gtcgagcgcgccttggcggcgcagctcaccacgctgccgcgcgtcaagatcgcgcgcgcc
tcgtgggacgagttcggcgccatcatcaaggtcgccaagctggaggatgcggtcccgctc
gccaacgcgatcgcggccgagcatctcgagatcatgacggccgatccggaagcgttcgcc
gacaagatccgcaatgccggcgcgatcttcctcggcggccatacgccggaagcgatcggc
gactatgtcggcggctccaaccacgtgctgccgaccgcgcgttcggcgcggttctcgtcg
ggcctcggcgtgctcgacttcatgaagcgcacctcgatcctgaagtgcgggcccgaacag
ctcgccgtgctcggcccggccgcgatggcgctcggcaaggccgaaggattggatgcgcat
gcgcgatcggtgggactgcgtctgaatcagcgatga

DBGET integrated database retrieval system