KEGG   Rhodopseudomonas palustris HaA2: RPB_0326Help
Entry
RPB_0326          CDS       T00321                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00020  Citrate cycle (TCA cycle)
rpb00190  Oxidative phosphorylation
rpb00650  Butanoate metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
Module
rpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPB_0326
   00650 Butanoate metabolism
    RPB_0326
  Energy metabolism
   00190 Oxidative phosphorylation
    RPB_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABD05037
UniProt: Q2J3C3
Position
complement(371494..371916)
Genome map
AA seq 140 aa AA seqDB search
MSVEESHGTARRRERTMRTPMGKVRKLGPAGSGTSDFWQQRITGVAMTLLILPVIVVIMM
LLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDYIQNEKLKLVTVMANNF
FSIAVALAAIFAIFKLASGV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgaggaatcccacggcaccgcacggcggcgcgagcgcacgatgcgcacgccg
atgggcaaggtgcgcaagctcggcccggccggctccggcacctcggacttctggcagcag
cgcatcaccggcgtggcgatgacgctgctgatcctgccggtgatcgtcgtgatcatgatg
ctgctcggccgcaatcaggccggcgcggcgcagatcctcggttcgccgctgatctcgctg
accatgatcctgttcatcatcgccagcgcgatccacatgaagatcggcatgcaggtggtg
atcgaggactacatccagaacgagaagctcaagctcgtcacggtgatggccaacaatttc
ttttcgatcgccgtggcgctcgccgcgatcttcgcgatcttcaaactcgcatccggagtg
taa

DBGET integrated database retrieval system