KEGG   Rhodopseudomonas palustris HaA2: RPB_0676Help
Entry
RPB_0676          CDS       T00321                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00300  Lysine biosynthesis
rpb01100  Metabolic pathways
rpb01120  Microbial metabolism in diverse environments
rpb01230  Biosynthesis of amino acids
Module
rpb_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RPB_0676
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RPB_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABD05387
UniProt: Q2J2C3
Position
complement(760634..761803)
Genome map
AA seq 389 aa AA seqDB search
MTATALEIAQALLRCPSVTPADAGALGVLEALLQDAGFATHRVTFSEPGTADIDNLYARI
GDGAPHLCFAGHTDVVPPGEETAWSHGAFAGDVEGGLLYGRGAVDMKGGIACAVAATLDY
LAANGGQPQQSGKGSISFLITGDEEDVAVNGTVKLLQWAAERGERFDHCIVGEPSNVEAI
GDTIKIGRRGSQSGVLIVDGRQGHVAYPHRASNPIPDIATLITALNDEPLDQGSAQFQPS
NLEFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQETLRALVEQRLAAACGNRIRARIEW
LPSNADVFVTKPGGFTDLVSAAIADITGRSPDLNTGGGTSDARFIAKYCPVVEFGLVGQT
MHQIDERTPVSDLDKLTAIYRGVLERYFR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgaccgcgctcgagatcgcgcaggcgctgctgcgctgtccgtcggtgacgccg
gccgatgccggcgcgctcggcgtgctggaggcgctgctgcaggacgcgggcttcgcgacg
catcgggtgactttcagcgagcccggcaccgccgacatcgacaatctctacgcgcggatc
ggtgacggtgcgccgcatctctgcttcgccggccacaccgacgtggtgccgcccggcgaa
gaaaccgcatggagccatggcgcgttcgcaggcgatgtcgaaggcggcctgctgtacggc
cgcggcgcggtcgacatgaagggcggcatcgcctgcgcggtggcggcgacgctggattat
ctggccgcgaatggcggccagccgcaacaatccggcaaaggctcgatctcgttcctgatc
accggcgacgaggaagacgtcgccgtcaacggcaccgtcaagctgctgcaatgggccgcc
gaacgcggcgagcgcttcgatcactgcatcgtcggcgagccgagcaatgtcgaggcgatc
ggcgacaccatcaagatcggtcggcgcggctcgcagtccggcgtgctgatcgtcgacggc
cggcagggccatgtcgcctatccgcaccgcgcatcgaatccgatccccgatatcgcaacg
ttgatcaccgcgctgaacgacgagccgctggatcaaggctcggcgcaattccagccgtcg
aacctcgaattcacctcggtcgacgtcggcaatccggccaccaatgtgatcccggcgcag
gcccgcgccaagttcaacatccgcttcaacgatcaccacacccaggagacgctgcgcgcg
ctggtcgagcagcggctcgccgccgcctgcggcaaccgcatccgcgcccgaatcgaatgg
ctgccgtcgaacgccgatgtgttcgtgacgaagcccggcggcttcaccgatctggtgtcg
gccgcgatcgccgacatcaccggccgcagccccgacctcaacaccggcggcggcacctcg
gatgcgcgcttcatcgccaaatactgtccggtggtcgagttcggcctggtcggccagacc
atgcaccagatcgacgaacgcacgcccgtgagcgatctcgacaagctcaccgcgatctat
cgcggcgtgctggagagatacttcaggtaa

DBGET integrated database retrieval system