KEGG   Rhodopseudomonas palustris HaA2: RPB_0784Help
Entry
RPB_0784          CDS       T00321                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00220  Arginine biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
rpb01230  Biosynthesis of amino acids
Module
rpb_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RPB_0784
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     RPB_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ABD05495
UniProt: Q2J215
Position
877779..878765
Genome map
AA seq 328 aa AA seqDB search
MSSATNRAVSSSKSTIESPAMTSAPRHFLDLTEVPTSELRNMLAAGVAMKAKRKANADAD
KPLAGKTLAMIFEKPSTRTRVSFDVGMRQLGGESIMLTGAEMQLGRGETIADTARVLSRF
VDIIMIRILNHDSLLELAANATVPVINGLTRKSHPCQVMADVMTFEEHRGPIKGATVAWT
GDDNNVLASWAHAAQRFDFRLNIATPPQLAPNKAMRDWIKTSGAAITLGSDAEAAVRGAD
CVVTDTWVSMGDKDGEHRHNLLKPFQVNAKLMSLAHKDAIFMHCLPAHRGEEVTDEVIDG
PQSVVFDEAENRLHAQKGILAWCLGAVA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgctaccaatcgtgcggtgagtagttccaagagtacgatcgagagtccagcg
atgaccagcgccccgaggcatttcctcgatctcaccgaggtcccgacctcggagctgcgc
aatatgctcgccgccggcgtggcgatgaaggcgaagcgcaaggccaatgcggatgccgac
aagccgctcgccggcaagacgctggcgatgatcttcgagaagccctcgacgcgcacccgc
gtctcgttcgacgtcggcatgcgccagctcggcggcgagtcgatcatgctgaccggcgcc
gagatgcagctcggccgcggcgagaccatcgccgacaccgcgcgggtgctgtcgcgcttc
gtcgacatcatcatgatccgcatcctcaatcacgactcgctgctggagctcgccgccaac
gctaccgtgccggtgatcaacgggctcacccgcaagtcgcatccgtgccaggtgatggcc
gacgtgatgacgttcgaggagcatcgcggcccgatcaagggcgcgaccgtggcctggacc
ggcgacgacaacaacgtgctggcgtcgtgggcgcatgccgcacagcggttcgatttcagg
ctcaacatcgcgaccccgccgcagctcgcgcccaacaaggcgatgcgcgactggatcaag
accagtggtgctgcgatcacgctcggcagcgacgccgaggcggcggtccgcggcgccgat
tgcgtcgtcaccgacacctgggtgtcgatgggcgacaaggacggcgagcaccgccacaat
ctgctgaagccgtttcaggtcaacgccaagctgatgtcgctcgcccacaaggacgcgatc
ttcatgcactgcctgccggcgcatcgcggcgaggaggtcaccgacgaggtgatcgacggc
ccgcaatcggtggtgttcgacgaagccgaaaaccgcctgcacgcgcagaagggcatcctg
gcctggtgcctcggcgcggtggcgtag

DBGET integrated database retrieval system