KEGG   Rhodopseudomonas palustris HaA2: RPB_1027Help
Entry
RPB_1027          CDS       T00321                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00430  Taurine and hypotaurine metabolism
rpb00620  Pyruvate metabolism
rpb00640  Propanoate metabolism
rpb00680  Methane metabolism
rpb01100  Metabolic pathways
rpb01120  Microbial metabolism in diverse environments
rpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPB_1027
   00640 Propanoate metabolism
    RPB_1027
  09102 Energy metabolism
   00680 Methane metabolism
    RPB_1027
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RPB_1027
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     RPB_1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABD05737
UniProt: Q2J1C3
Position
1178574..1179776
Genome map
AA seq 400 aa AA seqDB search
MNDMMLVLNAGSSSVKFALYEAHTEPTQDCLICEGGIGSLGHRPHHKVVDRHGATVHDAY
LADGAGHEEAIRTLMGWIAQRFPERRLAAAGHRVVHGGDLFDAPVRVDAGVIERLRGFIP
LAPLHQPHSIAAIESLARLDPRLPQIVCFDTAFHHGLPPLATWFALPRDLIAQGIRRYGF
HGVSYEYIASALPGVAGAAVAEGRVVVAHLGGGASMCAMRARKSVATTMGFTALDGLMMG
SRTGVLDPGVVLYLLEQKGMTPAEISDLLYRKSGLLGVSGISDDMRTLLASDDPHAEEAV
ALFVYRIGRELGSLAAALGGLDALVFTAGIGERSAEIRKRVCAQAAWLGVTLDAAANAHA
AGAARISIADSKVSVWVIPTDEDLMIARHVWRLVEGDRAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatgatgctggtgctgaatgccggctcgtcgagcgtcaaattcgccttgtac
gaggcgcacaccgagccgacgcaggactgcctgatctgcgagggcggcatcggcagcctc
ggccatcgcccgcaccacaaggtggtcgatcgccacggcgcgaccgtccacgacgcctat
ctggccgacggcgccggccatgaggaggcgatccgaaccctgatgggctggatcgcgcaa
cgctttcccgaacggcggctcgccgcggcggggcaccgcgtggtgcatggcggcgatctg
ttcgacgcgccggtgcgcgtcgatgccggcgtgatcgagcggctgcgcggcttcattccg
ttggcgccgctgcatcagccgcacagcatcgcggcgatcgagtcgctggcgagactggat
ccccggctgccgcagatcgtctgtttcgacacagcgttccaccacggattgccgccgctc
gccacctggttcgcgctgccgcgcgatctgattgcgcagggcatccgccgctacggcttt
cacggcgtgtcctacgaatacatcgccagcgcgctgccgggcgtggccggggcggcggtc
gccgagggccgcgtcgtggtcgcgcatctcggcggcggcgccagcatgtgcgcgatgcgg
gcgcgcaagagcgtggcgacgacgatgggtttcaccgcgctcgacggcctgatgatgggc
agtcgcaccggcgtgctcgatcccggcgtggtgctgtatctgctggagcagaagggcatg
acgcccgccgagatcagcgatctgctgtatcgcaaatcgggcctgctcggcgtctccggc
atcagcgacgacatgcggacgctgctggccagcgatgatccgcatgccgaggaagcggtc
gcgttgttcgtctatcgcatcggccgcgagctcggctcgctcgccgccgcgctcggcggg
ctcgacgcgctggtattcaccgccggcatcggcgagcgctccgccgagatccgcaagcgg
gtgtgcgcccaggcggcgtggctcggcgtcacgctcgacgccgccgccaatgcgcacgct
gcgggcgccgcgcgcatcagcatcgccgacagcaaggtctcggtctgggtgatcccgacc
gacgaggacctgatgatcgcccgccacgtctggcggctggtcgaaggcgaccgggcggcc
tga

DBGET integrated database retrieval system