KEGG   Rhodopseudomonas palustris HaA2: RPB_1086Help
Entry
RPB_1086          CDS       T00321                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00900  Terpenoid backbone biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPB_1086
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RPB_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABD05796
UniProt: Q2J164
Position
1247765..1248655
Genome map
AA seq 296 aa AA seqDB search
MPTTALSDQARAKVNLTLRVVGRRVDGYHDLESVVAFADCADRLTLHPGAELSLVTSGPG
AQDCGDTADNLVLKATRLLAERVPKLRSGAFVLDKHLPVAAGIGGGSADAAAALRLLARA
NDLAADDPRVVEAARLTGADVPVCLPSRPCVMTGVGDTLTPLPLPRLPAVMVNPRVPVAT
KDVFKALGLRAGQLNVGIVDVLKSKGWPAVDASVADWIVAVRRGTNDLEAPALKVEPIVG
DVLRALAALPGVRMSRMSGSGATCFALFASDEDTKAGAEVLRAAHPGWWIHAGSLS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgccgacaacggcgttgagcgaccaggcccgcgccaaggtcaatctcactttgcgagtc
gtgggccgccgcgtcgacggctatcacgacctcgaaagcgtggtggccttcgccgattgc
gccgaccgcctgacgttgcatccgggtgccgaactgagcctcgtcacctccggccccggc
gcgcaggattgcggcgacaccgccgacaatctggtgctcaaggcgacccgactgctcgcc
gagcgcgtcccgaaactgcgcagcggcgccttcgtcctcgacaagcatctgccggtcgcg
gccgggatcggtggcggctcggccgacgccgccgcggcgttgcggctgctcgcccgcgcc
aacgatctggcggccgacgatccgcgcgtggtcgaggcggcgcgtctcaccggggccgac
gtgccggtatgcctgccgtcccggccctgcgtcatgaccggagtcggcgatacgctgacg
ccgttgccgctgccgcggctgccggcggtgatggtcaatccgcgcgtgccggtggcgacc
aaggacgtgttcaaggcgctcggcctgcgtgccggtcagctcaatgtcggcattgtcgac
gtgctgaaatcgaagggctggcccgcggtggatgcgtccgttgccgactggatcgtggcg
gtgaggcgcggcacgaacgatctcgaggccccggcgctgaaggtcgagccgatcgtcggc
gatgtgctgcgggcgctcgccgcgctgccgggggtgcggatgtcgcggatgtccggctcc
ggcgcgacctgctttgcgctgttcgccagcgatgaagatacgaaggccggcgccgaggtg
ctacgcgccgcgcatcccggctggtggatccacgccggcagcctgagctag

DBGET integrated database retrieval system