KEGG   Rhodopseudomonas palustris HaA2: RPB_1346Help
Entry
RPB_1346          CDS       T00321                                 

Definition
(GenBank) ABC transporter related
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpb02000]
    RPB_1346
Transporters [BR:rpb02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    RPB_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N Zeta_toxin AAA_22 AAA_16 RsgA_GTPase AAA_29 AAA_30 Herpes_Helicase DUF87
Motif
Other DBs
NCBI-ProteinID: ABD06056
UniProt: Q2J0F4
Position
complement(1533628..1535436)
Genome map
AA seq 602 aa AA seqDB search
MSLFRVYTRVLELLGKERRLGWTLAVANLLLATAQFAEPVLFGRIVDVMSGNLATGALAP
EARSPWPLLAAWVGFGLFTIFCSAAVSLHADRLAHRQRQAVLTSYFEHILQLPTTFHTGT
HSGRLIKVMLQGTDALWRVWLGFFREHFAALLSLLVLLPLSLYINWRLAMLLFALCGVFT
VLTTLVVRKTYGLQSEVEAQYSDLSARASDALGNVALVQSYVRIDAEVQGLRFVADKLLA
AQMPVLSWWALVTVITRASTTITVLAIFALGIVLNQQGLTSIGEIVMFVSFATLLIQRLE
QVVSFVNSLMMEAPRLQEFIDVLDEVPAVRDRPNAIDPGRLSGLVEFQDVSFSYDGKRPA
VEDLSFTALPGQTIALVGATGAGKSTAIALLHRAFDPQSGTVKIDGMDIRGLTLAGLRRN
IGVVFQEALLFDRSIADNLRVGKPDATDAELRLAAERAQALDFIERSGLGFNTAAGERGR
MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKVNLALDEVMRGRTTFVIAHRL
STIRHATRILVFENGRVIESGTFDDLVAQRGHFAELARAQFMVQEDARASVAAAADHASV
RP
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtttcgtgtttatacgcgcgtgctcgagctgctcggcaaagagcggcggctc
ggctggacgctggccgtcgccaatctgttgctcgccaccgcgcaattcgccgaaccggtg
ctgttcggccggatcgtcgatgtgatgtccggcaatctcgccaccggcgcgctggcgccg
gaggcgcgctcgccgtggccgctgctcgccgcctgggtcggcttcggcctgttcacgatt
ttctgctcggccgccgtctcgctgcacgccgaccgtcttgcgcatcgccaaaggcaggcg
gtgctgaccagctatttcgaacacatcctgcagctgccgacgacgttccataccggcacg
cattcgggtcggctgatcaaagtgatgctgcagggcaccgatgcgctgtggcgggtgtgg
ctcggtttcttccgcgaacacttcgccgcgctgctctctttgctcgtgctgttgccgctg
tcgctgtacattaactggcggctggcgatgctgctgttcgcattgtgcggcgtgttcacg
gtgctgaccacgctggtggtccgcaagacctacggcctgcagagcgaggtcgaggcgcaa
tacagcgacctgtccgcccgcgcctccgatgcgctcggcaacgtcgcgctggtgcagagc
tacgtgcgaatcgacgccgaggtccagggcctgcgcttcgtcgccgacaagctgctggcg
gcgcagatgccggtgctgtcgtggtgggcgctggtgacggtcatcacccgcgcctcgacc
acgatcaccgtgctggcgatcttcgcgctcggcatcgtcctcaatcagcagggtctcacc
agcatcggcgagatcgtgatgtttgtgtcgttcgcgaccctgctgatccagcggctcgag
caggtggtgagcttcgtcaacagcctgatgatggaagcgccgcggctgcaggaattcatc
gacgtgctcgacgaggtgccggcggtccgcgaccggcccaatgcgatcgatccggggcgg
ctgtcggggctcgtcgaattccaggacgtgtcgttttcctatgacggcaagcggccggcg
gtcgaggatctgtcgttcaccgcgctccccgggcaaaccatcgcgctggtcggcgccacc
ggcgccggcaagtcgaccgcgatcgcgctgctgcaccgcgcgttcgatccgcagtccggc
acggtcaagatcgacggcatggatatccgcggcctgacgctggcggggctgcgacgcaac
atcggcgtggtgtttcaggaagcgctgctgttcgaccgctcgatcgccgacaatctgcgc
gtcggcaaacccgatgccaccgacgccgaattgcggctggcggccgagcgcgcgcaggcg
ctggatttcatcgagcgcagcggtctcggcttcaataccgccgcgggcgagcgcggccgc
atgttgtccggcggcgaacggcagcggctgtcgatcgcccgcgcgctgctgaaggatccg
ccgatcctgatcctcgacgaggcgacctcggcgctcgacgcggtgaccgaagccaaggtc
aatctcgcgctcgacgaggtgatgagaggccgcaccaccttcgtgatcgcgcaccggctc
tcgaccatccgccacgccacccgaatcctggtgttcgagaacggacgcgtgatcgaaagc
ggaacattcgatgacttggtggcgcagcgcggacacttcgcggaactggcgcgggcgcaa
ttcatggttcaggaggacgcccgggccagcgttgccgcagccgccgatcacgcgtccgtc
aggccgtga

DBGET integrated database retrieval system