KEGG   Rhodopseudomonas palustris HaA2: RPB_1445Help
Entry
RPB_1445          CDS       T00321                                 

Definition
(GenBank) SSU ribosomal protein S21P
  KO
K02970  small subunit ribosomal protein S21
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RPB_1445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rpb03011]
    RPB_1445
Ribosome [BR:rpb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    RPB_1445
  Bacteria
    RPB_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21 Ribosomal_S5
Motif
Other DBs
NCBI-ProteinID: ABD06155
UniProt: Q2J055
Position
complement(1632883..1633188)
Genome map
AA seq 101 aa AA seqDB search
MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK
KLQREGLLPMKPKPAFGAERGRPGAGGPGAGGPGAGPRGPR
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggttctcgttcgcgataacaatgtcgatcaagctctcaaggcgctcaagaagaag
atgcagcgcgagggcattttccgcgagatgaagctccgcggtcattacgagaagccgtcc
gagaagaaggcccgtgaaaaggccgaagccgttcgccgcgcccgcaagctggcccgcaag
aagctgcagcgcgaaggcctgctgccgatgaagccgaagccggcgttcggcgcagagcgt
ggccgtccgggtgccggtggccccggcgctggcggccccggtgcaggtccgcgcggtccg
cgctga

DBGET integrated database retrieval system