KEGG   Rhodopseudomonas palustris HaA2: RPB_1863Help
Entry
RPB_1863          CDS       T00321                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00230  Purine metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
Module
rpb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RPB_1863
Enzymes [BR:rpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     RPB_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_3 LAL_C2 ATP-grasp ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ABD06571
UniProt: Q2IYY9
Position
2127432..2128760
Genome map
AA seq 442 aa AA seqDB search
MLHLAHHPRGTVRLAMNILLLGSGGREHALAWKIAASPLVTKLFCAPGNAGIAREATCVA
LDVTDHAAVIDFCKANAIELVVVGPEAPLAAGIVDDLAGAGIKAFGPTQKAAQLEGSKGF
TKDLCKAHDIPTAAYERFSDPADAKAYIRVQGAPIVVKADGLAAGKGVVVAMTLAEAEDA
VDMMFGGALGDAGIEVVVEDFMIGEEASFFVLCDGEHALPLATAQDHKRAFDGDKGPNTG
GMGAYSPAPVMTDAICKQAMERIIGPTLKAMKAMGAPFKGVLFAGLMITEDGPQLIEYNV
RFGDPECQVLMMRMMSDIVPALLACVDGQLAHLTLRWFDEPALTVVMAAKGYPGGYEKGT
RIAGLDRAEQIPGVQIFHAGTVASGDWVLANGGRVLAVTASAKTVAEAQRRAYEAIGVIN
WPEGFCRRDIGWQAVARERRKK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgttacacctcgcgcaccatcctcggggtacggtcaggcttgcgatgaatattctgttg
ctcggctccggcgggcgcgaacacgcgctggcctggaagatcgccgcctccccgctggtg
accaagctgttttgcgcgccgggcaatgccgggatcgcgcgcgaggcgacctgcgttgcg
ctcgacgtcaccgaccatgccgcggtgatcgatttctgcaaggcgaatgccatcgaactg
gtggtggtcgggccggaggcgccgctcgccgccggcatcgtcgacgatctcgccggcgcc
ggcatcaaggcgttcggcccgacgcagaaggccgcgcagctcgaaggctccaagggcttc
accaaggatctgtgcaaggcgcacgacattcccaccgccgcctatgagcgcttcagcgat
cccgccgacgccaaggcctatatccgcgtgcagggcgcaccgatcgtggtcaaggccgat
gggctcgcggccggcaagggcgtcgtggtggcgatgacgctggccgaggccgaagacgcg
gtcgacatgatgttcggcggcgcgctcggcgacgccggcatcgaggtcgtggtcgaggat
ttcatgatcggcgaggaggcctcgttcttcgtgctgtgcgacggcgagcacgcgctgccg
ctcgccaccgcgcaggaccacaagcgcgccttcgacggcgacaaggggccgaacaccggc
ggcatgggggcgtattcgccggcgccggtgatgacggacgcgatctgcaagcaggcgatg
gagcgtatcatcggcccgacgctgaaggcgatgaaggcgatgggcgcgccgttcaagggc
gtgctgttcgccgggctgatgatcaccgaggacggtccgcaactgatcgaatacaatgtc
cgcttcggcgatccggaatgccaggtgctgatgatgcggatgatgtccgacatcgtgccg
gcgctgctcgcctgcgtcgatggccaactcgcccacctcacgctgcgctggttcgacgag
ccggcgctgaccgtggtgatggcggcgaagggctatccgggcggttacgaaaaaggcacg
cggatcgccggcctcgaccgcgccgagcagatccccggcgtgcagatcttccacgccggc
acggtcgcgtcgggcgactgggtgctcgccaatggcggccgcgtgctggccgtcaccgcc
tcggccaagacggtggccgaggcgcagcgccgcgcctacgaggcgatcggcgtcatcaac
tggcccgaaggcttctgccgccgcgacatcggctggcaggcggtggcgcgggaacgccga
aagaagtag

DBGET integrated database retrieval system