KEGG   Rhodopseudomonas palustris HaA2: RPB_2121Help
Entry
RPB_2121          CDS       T00321                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00071  Fatty acid degradation
rpb00280  Valine, leucine and isoleucine degradation
rpb00281  Geraniol degradation
rpb00310  Lysine degradation
rpb00360  Phenylalanine metabolism
rpb00362  Benzoate degradation
rpb00380  Tryptophan metabolism
rpb00410  beta-Alanine metabolism
rpb00627  Aminobenzoate degradation
rpb00640  Propanoate metabolism
rpb00650  Butanoate metabolism
rpb00903  Limonene and pinene degradation
rpb00930  Caprolactam degradation
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPB_2121
   00650 Butanoate metabolism
    RPB_2121
  Lipid metabolism
   00071 Fatty acid degradation
    RPB_2121
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPB_2121
   00310 Lysine degradation
    RPB_2121
   00360 Phenylalanine metabolism
    RPB_2121
   00380 Tryptophan metabolism
    RPB_2121
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPB_2121
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPB_2121
   00281 Geraniol degradation
    RPB_2121
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPB_2121
   00627 Aminobenzoate degradation
    RPB_2121
   00930 Caprolactam degradation
    RPB_2121
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPB_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABD06827
UniProt: Q2IY83
Position
2411942..2413015
Genome map
AA seq 357 aa AA seqDB search
MNIAVTEPDLIVRREGAAGVVRLNRPKALNALTLEMARGLDAALTEFEADPAIALILIEG
AGERGLCAGGDIVGLYNSAREGGDLGKVFWREEYVMNARIAKFPKPYVAYMDGFVMGGGV
GIAGHGSHRIVTDKTKIAMPEVGIGFFPDVGGTWLLSRAPGEIGTYFGLTGETMNGADAI
HTRFADAFVPASAWPELRAALTTASADAHADNVRGILARFTMTPEAGPAQRHAQQIDQWF
AHDTVEAIFADLERDRSDFAQATLKALRAKSPTSLKVALKLLRIARDAASLEDCLVHEYR
AALQVFVSYDFVEGIRAAVIDKDRAPKWRPATIEEVTPDIVARYFDDRGDDELKLPD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagcggtcactgagccggacctgatcgtccggcgcgagggcgcagccggcgtg
gtccgcctcaaccggccgaaagcgctgaatgcgctgacgctggagatggcgcgcggcctc
gacgccgcgttgaccgagttcgaggccgatccggccatcgcgttgatcctgatcgaaggc
gccggtgagcgcggcctgtgcgccggcggcgacatcgtcgggctgtacaacagcgcgcgc
gaaggcggcgatctcggcaaagtgttctggcgcgaagaatacgtcatgaacgcgcggatc
gcgaaatttcccaagccctatgtcgcctatatggatggcttcgtgatgggcggcggcgtc
ggcatcgctggtcacggcagccatcgcatcgtcaccgacaagaccaagatcgcaatgccg
gaagtcggcatcggcttcttccccgatgtcggcggcacctggctgctgtcgcgcgcgccc
ggcgagatcggcacctatttcggcctcaccggcgagaccatgaacggcgccgacgcgatc
cacacgaggtttgcggatgcgttcgtgccggcatccgcatggcctgaactccgcgccgcg
ctgacgacggcgtcggccgacgcccacgccgacaatgtccgcggcattctcgcgcgattc
acgatgacacccgaagccgggccggcgcagcgtcacgcgcagcagatcgaccaatggttc
gcccacgataccgtcgaggcgatcttcgcggatctcgagcgcgaccgctcggacttcgcg
caggcgacgctgaaagcgctgcgggccaagtcgccgaccagcctcaaggtcgcgctgaag
ctgttgcggatcgcgcgtgacgcggcgtcgctcgaagactgcctggtgcacgaatatcgc
gccgcgctgcaggtgttcgtgagctatgatttcgtcgagggcattcgcgccgcggtgatc
gacaaggaccgcgcgccgaaatggcggccggcgacgatcgaggaggtgacgccggacatc
gtggcgcgctactttgacgatcgcggcgacgacgagctgaaattgccggactga

DBGET integrated database retrieval system