KEGG   Rhodopseudomonas palustris HaA2: RPB_2184Help
Entry
RPB_2184          CDS       T00321                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00790  Folate biosynthesis
rpb01100  Metabolic pathways
Module
rpb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPB_2184
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RPB_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ABD06890
UniProt: Q2IY20
Position
2477826..2478515
Genome map
AA seq 229 aa AA seqDB search
MDAKIKPLRAGKSADARTDFQPAELDPSEFLAAAVQPDQPRPSRAEAEAAVKTLLSYIGE
NTEREGLLDTPRRVVEAYDELFQGYHQCPAEVLDRTFGETAGYDDFVLVRDISFTSHCEH
HVMPFYGKAHIAYTPVERVVGLSKLARLVEIFARRLQTQEHLTAQIAAAIDEVLKPRGVA
VMIEAEHTCMSVRGIGKQGASTFTSRYTGMFRDNPAEQARFMSMIRNRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaagatcaagccgctccgcgccggcaagtccgcggacgcccgcaccgatttt
caacccgccgagctcgacccgtcggaattcctcgctgccgcggtgcagccggatcagccg
cggccgtcgcgcgccgaagccgaggcggcggtgaagacgctgctgtcctatatcggcgag
aacaccgagcgggagggcctgctcgacaccccgcgccgggtggtcgaggcctatgacgaa
ctgttccagggctatcaccagtgcccggccgaagtgctcgaccgcaccttcggcgagacg
gccggctacgacgatttcgtgctggtgcgcgacatctccttcacctcgcattgcgaacac
cacgtcatgccgttctacggcaaggcgcatatcgcctacacgccggtcgagcgcgtcgtc
ggcctgtccaagctggcgcggctggtcgagattttcgcccgccggctgcagacccaggag
cacctcaccgcgcagatcgccgcggcgatcgacgaggtgctgaagccgcgcggcgtcgcg
gtaatgatcgaggccgagcacacctgcatgtcggtgcgcggcatcggcaagcagggcgcc
tcgaccttcaccagccgctacaccggcatgttccgcgacaatccggcggagcaggcgcgg
ttcatgtcgatgattcgcaaccgcggttaa

DBGET integrated database retrieval system