KEGG   Rhodopseudomonas palustris HaA2: RPB_2617Help
Entry
RPB_2617          CDS       T00321                                 

Definition
(GenBank) putative transcriptional regulator, TetR family
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: ABD07319
UniProt: Q2IWU1
Position
2999539..3000162
Genome map
AA seq 207 aa AA seqDB search
MIEGEAAVNSMDRIDFEASDRERPVMEATLRLIGRGGLKGVTHRAVAAETGLSLGAITHH
FGTRDLLVEAALKFALMREVRRLRALALSLQSDALDVEAWIDALVGWYTKELDSDAEIHI
ACYEAFLAAARDDRYRPIVAEWYETWRRSAELALTAAGSSRPQLHAEIFVSALVGIVLQQ
LAAPRRKFRAETRAALSELMRGLIGRT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaggtgaggcggctgtcaacagcatggacaggatcgatttcgaagcgagtgac
cgcgagcgcccagtgatggaggctacattgcgcctcatcgggcgcggtgggctcaagggc
gtcacccacagggcggtcgcggctgaaaccggcctgtcgctcggcgcgatcacccatcat
ttcggcacgcgcgatctgctggtcgaggccgcgctgaaattcgccctgatgcgcgaggtc
aggcgtctgcgcgcgctggcgctgagcctgcagagcgacgcgctcgacgtggaagcgtgg
atcgacgcgctggtcggctggtacaccaaagaactcgactccgacgccgagattcatatc
gcctgttacgaggcgttcctggcggcggcgcgcgacgatcgctaccggcctatcgtcgcc
gaatggtacgagacctggcggcgcagcgccgagctcgcgctgaccgcggcgggctcgagc
aggccgcagctgcatgcggagatcttcgtctcggcgctggtggggatcgtgctgcagcag
ctcgcggctccacgccggaaattccgggcggagacgcgggctgccttgtccgaattgatg
cgtggcctgatcggaagaacctag

DBGET integrated database retrieval system