KEGG   Rhodopseudomonas palustris HaA2: RPB_2618Help
Entry
RPB_2618          CDS       T00321                                 

Definition
(GenBank) NmrA-like protein
  KO
K19267  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00130  Ubiquinone and other terpenoid-quinone biosynthesis
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    RPB_2618
Enzymes [BR:rpb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     RPB_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA 3Beta_HSD RmlD_sub_bind NAD_binding_4 Sacchrp_dh_NADP Epimerase Mur_ligase TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABD07320
UniProt: Q2IWU0
Position
complement(3000159..3001043)
Genome map
AA seq 294 aa AA seqDB search
MSSPRFLVTGANGQLGRRVIDTLLGTISAPQISALVRGADAAAALSARGIQAHVGDYGRP
ETLAPALAGVDRVLLISSSEIGRRTPQHRNVIAAAREAGVQFLAYTSLLHADISPLGLAE
EHRQTEAALRESGVPFALLRNGWYTENYAASIPAALAHSALLGSAGDGRISSASRADYAA
AAAAVLTADTPAANQVYELAGDEAYTLTEFAAEIARQSGKAVAYRDLPEADYKAALLGAG
LPEPFAALLADSDAGAAKDALFDDSRTLSRLIGRPTTPYAETIGDTLKASRPER
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccccgttttctcgtcaccggcgccaacggccaactcggccgtcgcgtcatc
gatacccttctcgggaccatatcggccccgcagatcagcgccctggtccgcggtgccgac
gccgccgccgcgctgtcggcccgcggcattcaggcccatgtcggcgattacggccgcccg
gagacgctcgcgccggccctcgccggggtcgatcgggtgctgctgatctcatccagcgag
atcggtcggcgcacgccgcagcatcgcaacgtgatcgcggccgcccgcgaggccggggtc
cagttcctcgcctacaccagcctgctgcatgccgacatctcgccgctcggcctcgccgaa
gagcatcgccagaccgaagcagcgctccgcgagtccggcgtgccgttcgcgctgctgcgc
aacggctggtacaccgagaattatgccgcctcgatccccgccgcgctggcgcacagcgcg
ctgctcggcagcgccggcgacggacggatttcatcggcatcgcgggccgactatgcggcg
gcggccgccgcggtgctgaccgcggacacgccggccgccaaccaagtctacgaactcgcc
ggcgatgaggcctacacgctgaccgagttcgccgccgagatcgcgcggcagtccggcaag
gccgtcgcctaccgcgatctgcccgaggccgactacaaggccgcgctgctcggcgccggc
ctgccggagccgtttgcggcactgctggccgactccgacgccggcgccgccaaggacgcg
ctgttcgacgacagccgcaccctcagccgcctgatcggccgcccgaccacgccgtatgcc
gaaacgataggcgacacgttgaaggcatcaaggcctgagcgctag

DBGET integrated database retrieval system