KEGG   Rhodopseudomonas palustris HaA2: RPB_2620Help
Entry
RPB_2620          CDS       T00321                                 

Definition
(GenBank) DNA topoisomerase IV subunit A
  KO
K02621  topoisomerase IV subunit A [EC:5.99.1.-]
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rpb03032]
    RPB_2620
   03036 Chromosome and associated proteins [BR:rpb03036]
    RPB_2620
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:rpb02048]
    RPB_2620
Enzymes [BR:rpb01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     RPB_2620
DNA replication proteins [BR:rpb03032]
 Prokaryotic Type
  DNA Topoisomerases
   RPB_2620
Chromosome and associated proteins [BR:rpb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    RPB_2620
Prokaryotic defense system [BR:rpb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    RPB_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ABD07322
UniProt: Q2IWT8
Position
3001661..3003922
Genome map
AA seq 753 aa AA seqDB search
MGKRLIPPEPAEIHEVQLREALEERYLAYALSTIMHRALPDARDGLKPVHRRILYGMRLL
RLDPGTPFKKSAKIVGDVMGSFHPHGDQSIYDALVRLAQDFSSRYPLVDGQGNFGNIDGD
NPAAYRYTEARMTDVARLLLDGIDEDGVAFRPNYDGQAKEPVVLPGGFPNLLANGAQGIA
VGMATAIPPHNAAELCDAALHLIDKPDAKTKALLRFVKGPDFPTGGIVIDSKESIAEAYT
TGRGAFRTRAKWMQEEGARGTWVVVVTEIPWLVQKSRLIEKIAELLNEKKLPLVGDIRDE
SAEDVRVVIEPKSRAVDPALMMESLFRLTELESRIPLNLNVLVKGRIPKVLGLAECLREW
LDHLRDVLLRRSNYRKAQIEHRLEVLGGYLIAYLNIDKVIKIIRTEDEPKPVLMKAFNLT
DVQAEAILNMRLRSLRKLEEFEIRTEDKNLRAELKGINAILKSETEQWAKVGEQVRKVRE
MFGPKTPLGKRRTQFADAPEHDLAAIEEAFVEREPVTVVISDKGWVRTLKGHVADLSGLN
FKQDDKLDRAFFAETTSKLLLLATNGRFYSLEVAKLPGGRGHGEPIRMFIDMEQDAAIVA
MFVHKGGRKFLIASHDGQGFVVGEDDCVGTTRKGKQIINVEMPNEARALTVVGDGSDNVA
VIGDNRKMLIFPLDQVPEMARGRGVRLQKYKDGGLSDIVTFVAKEGLSWRDSAGREFSAT
MKELAEWRGNRADAGRMPPKGFPKSNKFGRGIE
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaagactgattccgccggagccggccgagattcacgaagtgcagcttcgtgaa
gcgctggaagagcgttacctcgcttatgcgctctcgaccatcatgcatcgcgccttgcct
gacgctcgcgacgggctgaagccggtgcatcggcgtattctttatggcatgcggctgttg
cggctcgaccccggcacgccgttcaagaagtcggccaagatcgtcggcgacgtgatgggc
tcgttccatccgcacggcgaccagtcgatctacgacgcgctggtgcgcctcgcgcaggac
ttctcctcgcgctatccgctggtcgacggccagggaaacttcggcaatatcgacggcgat
aatccggccgcctatcgctacaccgaagcgcgcatgaccgatgtcgcgcggctcttgctc
gatggtatcgacgaggacggcgtcgcgtttcggcccaactacgacggccaggccaaagag
ccggtggtgctgcccggcggctttccgaacctgcttgccaacggcgcgcagggcatcgcg
gtcggcatggccaccgcgatcccgccgcacaacgccgccgaactctgcgacgccgcgctg
catctgatcgacaagccggacgccaagacgaaggcgctgctgcgcttcgtcaagggcccg
gacttcccgactggcggcatcgtcatcgattccaaggagagcatcgccgaggcctatacg
acgggccgcggcgcgttccgcacccgcgccaaatggatgcaggaggagggcgcacgcggc
acctgggtcgtggtcgtcaccgaaattccgtggctggtgcagaagtcccggctgatcgag
aagatcgccgaactgttgaacgagaagaagctgccgctggtcggcgacatccgcgacgaa
tccgccgaagacgtgcgcgtcgtgatcgagccgaagtcgcgcgccgtcgatccggcgctg
atgatggaatcgctgttccggctgaccgagctggaaagccggatcccgctcaatctcaac
gtgctggtgaagggtcgcatccccaaggtgctcggcctcgccgaatgtctgcgcgaatgg
ctcgaccatctgcgcgacgtgctgctgcggcgctcgaactaccgcaaggcgcagatcgag
catcggctcgaagtgctcggcggctatctgatcgcgtatctaaacatcgacaaggtgatc
aagatcatccgcaccgaggacgagccgaaacccgtcctgatgaaggccttcaacctcacc
gatgtgcaggccgaagcgatcctcaacatgcggctgcgcagcttgcgcaagctcgaggaa
ttcgagatccgcaccgaggacaagaatctgcgcgccgagctgaagggcatcaacgcgatt
ctgaaatccgagaccgagcagtgggccaaggtcggcgagcaggtgcgcaaggtgcgcgag
atgttcgggccgaagacaccgctcggcaagcgccgcacccaattcgccgacgcgcccgag
cacgatctcgccgcgatcgaggaagccttcgtcgagcgcgagccggtcaccgtggtgatc
tccgacaagggctgggtgcgcaccctgaagggccacgtcgccgatctgtccggtctgaac
ttcaagcaggacgacaagctcgatagggcgttcttcgccgagaccacgtcgaagctgctg
ctgctcgccaccaatgggcggttctactcgctcgaggtcgccaagctgcccggcggccgc
ggccatggcgagccgatccgcatgttcatcgacatggagcaggacgccgccatcgtcgcg
atgttcgtgcacaagggcggtcgcaaattcctgatcgccagtcatgacggccagggattc
gtcgtcggcgaggacgattgcgtcggcaccacccgcaagggcaagcagatcatcaatgtc
gagatgccgaacgaggcgagggcgctgaccgtcgtcggcgacggctcggacaacgtcgcg
gtgatcggcgacaaccgcaagatgctgatcttcccgctcgaccaggtgccggagatggcg
cgcggccgcggcgtgcggctgcagaaatacaaggacggcgggctgtccgacatcgtcacc
ttcgtggccaaggaaggtctgagctggcgcgactccgccggccgcgagttcagcgcgacg
atgaaggaactggccgaatggcgcggcaatcgcgccgatgccggccgaatgccgccgaag
ggttttccgaagtcgaacaaattcggccgcggcatcgagtga

DBGET integrated database retrieval system