KEGG   Rhodopseudomonas palustris HaA2: RPB_2622Help
Entry
RPB_2622          CDS       T00321                                 

Definition
(GenBank) RDD
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD
Motif
Other DBs
NCBI-ProteinID: ABD07324
UniProt: Q2IWT6
Position
complement(3004944..3005486)
Genome map
AA seq 180 aa AA seqDB search
MSDYGSNGPGARGNAGWRDEGETFDPWRNPELFQGVLTKRVFAFLIDLVVLSIPVILAIV
FITVFGVITLGLGWTLFWIVSPASVIWALIYYGASLGGPYSATLGMRAMGIEMATWTGEP
GYFVLGAVHAFLFWLSVSMLTPLVLLVGLFNGRRRLLHDIVLGTVVINSMAVASQPARSY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactacggttcgaacgggcctggtgcgcgtggaaatgccggctggcgcgacgag
ggggaaaccttcgatccctggcgcaatccggagctattccagggtgtgctgaccaagcgc
gtgttcgctttcctgatagacttggtggtgttgtcgatcccggtgattctcgccatcgtc
ttcatcacggtgttcggcgtgatcacgctggggctgggctggacgctgttctggatcgtg
tcgccggcctcggtgatctgggcgctgatctattacggcgcgtcgctcggcgggccgtat
tcggcgacgctcggcatgcgggcgatgggtatcgagatggcgacgtggaccggcgagccg
ggctatttcgtgctcggcgcagtgcacgctttcttgttctggctgtcggtatcgatgctg
acgccgctggtgctactggtcggcctgttcaacggccgccgccggctgctgcacgatatc
gtgctcgggacggtggtgatcaacagcatggcggtcgcgtcacagccggcgcggtcgtac
tga

DBGET integrated database retrieval system