KEGG   Rhodopseudomonas palustris HaA2: RPB_2623Help
Entry
RPB_2623          CDS       T00321                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00860  Porphyrin and chlorophyll metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPB_2623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpb04147]
    RPB_2623
Enzymes [BR:rpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RPB_2623
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPB_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABD07325
UniProt: Q2IWT5
Position
complement(3005621..3006673)
Genome map
AA seq 350 aa AA seqDB search
MAIKFGRPIEMRDPAPRPSAPCLDLTVRPRRNRKSEWARRLVRENCVTTDDLIWPLFVVE
GSNQRVEIASMPGVERLSVDQVVRAAERAAKLDIPCIALFPYTDPSLRDEHGTEATNAEN
LVCRTVRAIKKEFPEIGVLCDVALDPFTSHGHDGLIQDGRILNDETVAVLVQQALVQAQA
GCDVIAPSDMMDGRIGAIRAGLDDAGFQDVQIMAYAAKYASAFYGPFRDAIGSAKALTGD
KRTYQMDPANTDEAIREVELDLAEGADMVMVKPGMPYLDIVRRVKETFAVPTFAYQVSGE
YAMIAAAANNGWLDGERAMMESLLGFKRAGADGVLTYFAPQAAEKLKQQG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaattcggccgtcccatcgaaatgcgcgaccccgccccccggccgtccgcc
ccgtgcctcgacctcaccgtgcgcccgcgtcgcaaccgcaagtccgaatgggctcgccgg
ctggtgcgggagaattgcgtcaccacggacgacctgatctggccgctgttcgtggtcgaa
ggcagcaatcagcgggtcgagatcgcctcgatgccgggcgtcgagcggctcagcgtcgat
caggtggttcgcgccgccgagcgcgccgccaaactcgacatcccctgcattgcgctgttc
ccctacacggacccgtcgctgcgcgacgagcacggcacggaagcgaccaacgccgagaac
ctggtgtgccgcacggtgcgcgccatcaagaaggagttccccgagatcggcgtgctgtgc
gacgtggcgctcgatccgttcaccagccatggccatgatggcctgatccaggacggccgc
atcctcaacgacgagaccgtcgcggtgctggtccaacaggcgctggtgcaggcccaggcc
ggctgcgacgtgatcgcgccgtccgacatgatggacggccgcatcggcgccatccgcgca
ggcctcgacgacgccggcttccaggacgtccagatcatggcctatgcggcgaaatacgcc
tcggcgttctacggcccgttccgcgacgcgatcggctcggccaaggcgctgaccggcgac
aagcgcacctaccagatggacccggccaacaccgacgaggcgatccgcgaggtcgaactc
gacctcgccgagggcgccgatatggtcatggtgaagcccggcatgccctatctcgacatc
gtccgccgggtgaaggagaccttcgcggtgccgaccttcgcctatcaggtgtcgggcgaa
tacgcgatgatcgccgcggccgcgaacaacggctggctcgacggcgagcgggcgatgatg
gagagcctgctcggcttcaagcgcgccggcgccgacggcgtactgacctacttcgccccg
caggccgccgagaagctgaaacagcaaggctga

DBGET integrated database retrieval system