KEGG   Rhodopseudomonas palustris HaA2: RPB_2625Help
Entry
RPB_2625          CDS       T00321                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABD07327
UniProt: Q2IWT3
Position
3007401..3008966
Genome map
AA seq 521 aa AA seqDB search
MSQLHSGGTTGSLIVNAIARYADRPAIADDNLRWTYREFGEAVGRFITLFRTVGLAKGSA
LSILSSNRAESWAAISAATVMGLRYTPLHPMAAEDDHAFIIEDAEIDALIVEAGKFAARG
LAIRARVPGLKHLLSFGAVEGARDLLDGFTAVEPAPLVDDSETADIAWLAYTGGTTGRSK
GVMIPHRSLSTMAVILYADWDWPAEIRYLAATPISHAAGITVYVVMMRGGFTRLVQGFEI
ESYCRVVAEDNITAAFLVPTLIYALIDAEAVRARHDLSSLDMIVYGAAPMSPDRLREGIK
IFGNVFVQLYGQTEAPQCITTMRKIDHDDRIPGRLGSCGRPSPLLDVRLLDSELREVATG
EPGEICVRGTLVMDGYWKRPEATQEAFRGGWLHTGDVAIKDADGYLYIVDRTKDMIISGG
FNIYPREVEDALMAHHGVASAAVIGVPDEKWGEAVKAFVVLKPGANNDAAELQAHVKERR
GAPWSPKSIEFVATIPVTGLGKIDRKVLRAPYWEGRTRGVA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcttcattccggcggaaccaccggcagcctgatcgtcaacgcgatcgcgcgc
tatgccgaccggccggcgatcgccgacgacaatctgcgctggacctatcgcgaattcggc
gaagcggtcggccgcttcatcaccctgttccggaccgtcggcctcgccaagggcagcgcg
ctgtcgatcctgtcgtcgaaccgcgccgagtcctgggcggcgatctcggccgcgacggtg
atgggcctgcgctacacgccgctgcatccgatggctgccgaggacgatcacgccttcatt
atcgaggatgccgagatcgacgcgctgatcgtcgaggccggcaaattcgccgcgcgcggg
ctggcgatccgcgcccgcgtgccgggcctgaagcatctgctgtcgttcggcgcggtcgag
ggcgcgcgcgatctgctcgatggcttcaccgcggttgagccggcgccgctggtcgacgac
agcgagaccgcggacatcgcctggctggcttacaccggcggcaccaccggccgctccaag
ggcgtgatgatcccgcatcgctcgctctcgacgatggccgtgatcctctatgccgactgg
gactggccggcggagatccgctatctggccgcgacgccgatcagccatgccgccggcatc
accgtctatgtggtgatgatgcgcggcggcttcacccggctggtgcagggcttcgagatc
gagtcctattgccgcgtggtggccgaggacaacatcaccgccgccttcctggtgccgacg
ctgatctacgcgctgatcgacgccgaagcggtgagggcacgtcacgacctgtcgtcgctc
gacatgatcgtctatggcgccgcgccgatgtcgcccgaccggctgcgcgaaggcatcaag
atcttcggcaatgtgttcgtgcagctctacggccagaccgaagcgccgcaatgcatcacc
acgatgcgcaagatagatcacgacgaccgcatccccggccggctcggctcgtgcggacgt
ccgagtccgttgctcgacgtccggctgctcgattccgaactgcgcgaggtggccaccggc
gagccgggcgagatctgcgtccgcggcacgctggtgatggacggttactggaagcgcccg
gaggcgacgcaggaagcgttccgcggcggctggctgcacaccggcgacgtcgcgatcaag
gacgccgacggttacttgtacatcgtcgatcgcaccaaggacatgatcatctcgggcggc
ttcaacatctacccgcgcgaggtcgaggacgcgctgatggcgcatcacggcgtcgcctcg
gcagccgtgatcggcgttccggacgagaaatggggggaggcggtcaaggccttcgtggtg
ctcaagcccggcgccaacaacgacgcggcggagctgcaggcgcatgtgaaggagaggcgc
ggcgcgccgtggtcgccgaaatcgatcgagttcgtcgcgacgattccggtgacgggtctc
ggcaagatcgaccgcaaggtgctgcgcgcgccgtattgggaaggccgcacgcgcggcgtc
gcctaa

DBGET integrated database retrieval system