KEGG   Rhodopseudomonas palustris HaA2: RPB_2626Help
Entry
RPB_2626          CDS       T00321                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_27 MarR_2 HTH_20 MarR HxlR HTH_34 OrfB_IS605
Motif
Other DBs
NCBI-ProteinID: ABD07328
UniProt: Q2IWT2
Position
3009298..3009816
Genome map
AA seq 172 aa AA seqDB search
MIKAVATAAEAAAPAVAGQAPVQPLYLEALTLVERLHRRLLDVIKDEFDRRGRADINSVQ
ALLLYNIGDKELTAGELRTRGYYLGSNVSYNLKKLVELGFLDHQRSRVDRRSVRIRLTAQ
GQEVRHIVDALYQKHVKTVEQVGGISSEEFATLNKSLHRLERFWTDQILYRL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagccgttgccacggcagccgaagccgccgcgcccgcagtcgcaggacaagcg
ccggtccagccgctctatctcgaggccctgacgctggtggagcggctgcatcgccgcctg
ctcgacgtcatcaaggacgaattcgaccgccgcggtcgcgccgatatcaactcggtgcag
gcgctgctgctctacaacatcggcgacaaggaactgaccgccggcgagctgcgcacgcgc
ggttactatctcggctccaacgtctcctacaatctgaagaaactcgtcgaactcggcttc
ctcgatcatcagcgctcgcgcgtcgatcgccgctcggtgcggatccgtctcaccgcgcag
ggccaggaagtccgtcacatcgtcgacgcgctgtatcagaagcacgtcaagacggtggag
caggtcggcggcatttccagcgaggaattcgccacgctgaacaagtcgctgcaccggctc
gagcggttctggaccgaccagatcctgtaccggctctga

DBGET integrated database retrieval system