KEGG   Rhodopseudomonas palustris HaA2: RPB_2635Help
Entry
RPB_2635          CDS       T00321                                 

Definition
(GenBank) Protein of unknown function DUF193
  KO
K07738  transcriptional repressor NrdR
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rpb03000]
    RPB_2635
Transcription factors [BR:rpb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    RPB_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-cone TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABD07337
UniProt: Q2IWS3
Position
3016008..3016490
Genome map
AA seq 160 aa AA seqDB search
MRCPNCNSLDTQVKDSRPTEDSSVIRRRRVCIACNFRFTTFERVQLRELTVIKRNGRRVP
FDRDKLVRSLQISLRKRPVEPERVEQMVSAIVRELESGGEADISSETIGEIVMDHLRKLD
DVAYVRFASVYRNFREAKDFEAVLGELSGEEEARPALVRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcccgaactgcaacagcctcgatacccaggtgaaggactccaggcccaccgag
gattcctcggtgatccggcggcgacgggtctgcatcgcctgcaatttccgcttcaccacc
ttcgagcgggtgcagctccgcgagctgacggtgatcaagcgcaacggccgccgggtgccg
ttcgatcgcgacaagctggtgcgctcgctgcagatcagcctgcgcaagcggccggtcgag
ccggagcgggtcgagcagatggtatcggcgatcgtgcgcgagctggaaagcggcggcgag
gccgacatctcgtcggagaccatcggcgagatcgtgatggaccatctgcgcaagctcgac
gacgtcgcttatgtgcggttcgcctcggtgtatcgcaatttccgcgaggccaaggacttc
gaggcggtgctcggcgaattgtccggcgaggaggaggcccggccggcgctggtccgcaaa
tga

DBGET integrated database retrieval system