KEGG   Rhodopseudomonas palustris HaA2: RPB_2638Help
Entry
RPB_2638          CDS       T00321                                 

Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00740  Riboflavin metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RPB_2638
Enzymes [BR:rpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     RPB_2638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMRL_synthase IalB
Motif
Other DBs
NCBI-ProteinID: ABD07340
UniProt: Q2IWS0
Position
3018366..3018908
Genome map
AA seq 180 aa AA seqDB search
MDRRVEPGNDDQRQGTRMADARRAPLKDQTDVSGARVLIVEARFYDDIQDALLDGAIAEL
KAAGASHDVLTVPGALEIPAAVAIAIDAAEAAGRPYDAAIALGCVVRGETIHFEIVSMES
ARALMDLSVARKFPLGNGIITVNTDEQAWARAKPDDLNKGGDAARAALAMLRIKRRLARG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccgggtcgagcccggcaatgacgaccaaaggcaaggcaccagaatggcagac
gcgcggcgcgcacccctgaaagaccagaccgacgtttcgggcgcgcgcgtcctgatcgtc
gaggcgcggttctacgacgatatccaggacgcgctgctggacggcgcaatcgccgaactg
aaagcagccggcgcgagccacgacgtgctgaccgtgcccggcgcgctggaaatccccgcc
gcggtggcgatcgcgatcgacgccgccgaggccgccggcaggccctatgatgcggcaatc
gcgctcggctgcgtggtgcggggcgagaccatccatttcgagatcgtctcgatggagtcg
gcgcgcgccctgatggacctgtcggtggcgcggaaattcccgctcggcaacggcatcatc
accgtcaacaccgacgaacaggcctgggcgcgagcaaagcccgacgatctcaacaagggc
ggtgacgccgcgcgcgccgcgctggcgatgctgcggatcaagcgccgactggcgcggggc
tga

DBGET integrated database retrieval system