KEGG   Rhodopseudomonas palustris HaA2: RPB_2641Help
Entry
RPB_2641          CDS       T00321                                 

Definition
(GenBank) V-type H(+)-translocating pyrophosphatase
  KO
K15987  K(+)-stimulated pyrophosphate-energized sodium pump [EC:3.6.1.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPB_2641
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     RPB_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H_PPase
Motif
Other DBs
NCBI-ProteinID: ABD07343
UniProt: Q2IWR7
Position
3020836..3022959
Genome map
AA seq 707 aa AA seqDB search
MTALWVIVLCGALAIVYAVWATSSVLAADQGNARMQEIAAAVREGAQAYLKRQYMTIAIV
GVVIFALLAYFLGVLVAIGFLIGAVLSGAAGFIGMNVSVRANVRTAQAATTSLAGGLELA
FKAGAITGLLVAGLALLGVTLYFIYLIHYANLAPNSRTVVDALVALGFGASLISIFARLG
GGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFETYAVTAV
ATMVLAAIFFAATPDLLLNMMTLPLAIGGICILTSIAGTFFVKLGASQSIMGALYKGLIA
TGVLSLIGVGAVIHQLIGFGPLAGVSYTGLALFECGIVGLAVTGLIIWITEYYTGTDYRP
VKSIAQSSVTGHGTNVIQGLAISMESTALPAIVIIAGILVTYSLAGLFGIAIATTTMLAL
AGMIVALDAFGPVTDNAGGIAEMAGLPKEVRKATDALDAVGNTTKAVTKGYAIGSAGLGA
LVLFAAYNEDLKFFIANAAKYPYFEGVLPDFSLNNPYVVVGLLFGGLLPYLFGAMGMTAV
GRAAGAIVEEVRRQFREKPGIMKGTDKPDYGKAVDLLTKAAIKEMIIPSLLPVLSPIFVY
FVIYAIAGGGPAGKSAAFSAVGAMLLGVIVTGLFVAISMTSGGGAWDNAKKYIEDGHHGG
KGSDAHKAAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAILAH
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgacagctttatgggtgatcgtgctctgcggagcgcttgcgatcgtatacgccgtctgg
gcgacctcgtcggtgctcgccgccgatcagggcaacgcgcggatgcaggaaatcgccgcc
gccgtgcgtgaaggcgcgcaggcctatctgaagcgccagtatatgaccatcgccatcgtc
ggcgtggtgatcttcgcgctgctcgcttactttctcggcgtcctcgtcgcgatcggcttc
ctgatcggcgcggtgctgtcgggcgcggccggcttcatcggcatgaacgtgtcggtgcgt
gccaacgtccgcaccgcgcaggcggcgaccacctcgctcgccggcggcctcgagctcgcc
ttcaaggctggcgccatcaccggccttctggtcgcgggtctcgcgctgctcggcgtgacg
ctgtatttcatctatctgatccactacgccaatctggctccgaacagccgcaccgtggtc
gacgcgctggtcgcactcggcttcggcgcctcgctgatctcgatcttcgctcgtctcggc
ggcggcatcttcaccaagggtgcggacgtcggcggtgatctcgtcggcaaggtcgaagcc
ggcattccggaagacgatccgcgcaacccggcgacgatcgccgacaacgtcggcgacaat
gtcggcgactgcgccggcatggccgccgatttgttcgagacctatgcggtgaccgcggtc
gccaccatggtgctcgccgcgatcttcttcgccgccacgcctgacctgttgctcaacatg
atgacgctgccgctcgccattggcggcatctgcatcctgacctcgatcgccggcaccttc
ttcgtcaagctcggcgcatcgcagtcgatcatgggggcgctgtacaaggggctgatcgcc
accggcgtgctgtcgctgatcggcgtcggcgccgtgatccaccagttgatcggcttcggt
ccgctggccggcgtcagctacaccggcctggcgctgttcgaatgcggtatcgtcggtctc
gccgtcaccggcctgatcatctggatcaccgaatactacaccggcaccgactaccggccg
gtgaagtcgatcgcgcaatcgtcggtcaccggccacggcaccaacgtgatccagggcctc
gccatctcgatggaatcgaccgcgctgcccgcgatcgtgatcatcgccggcatcctggtc
acctacagcctcgccggcctgttcggcatcgcgatcgccaccaccacgatgctggcgctg
gccggcatgatcgtggcgctcgacgccttcggcccggtcaccgacaatgccggcggcatc
gccgaaatggccggcctgccgaaggaagtccgcaaagccaccgacgcgctcgacgccgtc
ggcaacaccaccaaggcggtgaccaagggctacgcgatcggctccgccggtctcggcgcg
ctggtgctgttcgcggcgtataatgaagatctcaaattcttcatcgccaacgccgcgaag
tatccgtacttcgagggcgtgctgcccgacttctcgctgaacaacccctacgtcgtggtc
ggcctgctgttcggcggcctgctgccgtatctgttcggcgcgatgggcatgaccgcggtc
ggccgcgccgccggcgcgatcgtcgaggaagtgcgtcgccagttccgcgaaaagccgggc
atcatgaagggcaccgacaagccggattacggcaaggcggtcgacctgctgaccaaggcg
gcgatcaaggaaatgatcatcccgtcgctgctgccggtgctgtcgccgatcttcgtctac
ttcgtgatctacgcgatcgcgggcggcggtccggccggcaagtcggcggcgttctccgcg
gtcggcgcgatgctgctcggcgtcatcgtcaccggcctctttgtggcgatctcgatgact
tcgggcggcggcgcctgggacaacgccaagaagtacatcgaggacggccaccacggcggc
aagggctccgacgcccacaaggccgcggtgaccggcgacaccgtcggcgacccctacaag
gacacggcgggccccgccgtgaacccgatgatcaagatcaccaacatcgtggcactcttg
ctgctggcgatcctggcgcactga

DBGET integrated database retrieval system