KEGG   Rhodopseudomonas palustris HaA2: RPB_2643Help
Entry
RPB_2643          CDS       T00321                                 

Definition
(GenBank) HAD-superfamily hydrolase subfamily IA, variant 3
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00630  Glyoxylate and dicarboxylate metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_2643
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     RPB_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Hydrolase_3 DUF1967 NIF
Motif
Other DBs
NCBI-ProteinID: ABD07345
UniProt: Q2IWR5
Position
3023883..3024566
Genome map
AA seq 227 aa AA seqDB search
MKAFFFDLDGTLTDSRTGLHDSFRAAIEAIGVMPLGDAELDLFLGTPLPEMFRTLKADIS
QAGIEAGIDAFRAYYETHGIRQNRAYPGVREMLEALKTRRIPVWVVTSKPQAYAERVIRD
LGFADLVTDVVGAGLAELDTKSDLVKRALGEAGVAPGDAVMVGDRRYDVEGAKANGVVAV
GVTWGYGTREELESAGCDRLVESVSEFCQIFIDRSIVLRTRTAAAAC
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttttcttcgacctcgatggcacgctgaccgactcgcggacggggctgcac
gattcgtttcgcgcggcgatcgaagcgatcggcgtgatgccgcttggcgacgccgagctt
gacctgttcctaggcacgcctctgccggagatgttccgaacgttgaaggccgacatcagc
caggccggaatcgaggccggcatcgacgctttccgggcttactacgaaacccacggtatc
cgtcaaaaccgtgcctatcccggagttcgggagatgctggaggctttgaagaccagacgg
attcctgtctgggtcgtgacctccaagccccaggcctatgccgagcgtgtgatccgcgat
ctaggctttgccgatttggtcaccgacgtcgtcggcgcggggctcgcggagttggacact
aaaagcgatctggtgaagcgcgcgctcggcgaagcgggcgtcgcccctggcgatgccgtg
atggtcggagaccggcgctatgatgtcgaaggggccaaggccaatggtgtcgtcgctgtc
ggcgtgacttggggctacggcacgcgcgaagaactcgagtccgcgggctgcgatcgcctc
gtcgagtccgtttcggagttctgtcagatcttcatcgatcgctcgatcgtgcttcgtacc
aggaccgccgccgcggcctgctga

DBGET integrated database retrieval system