KEGG   Rhodopseudomonas palustris HaA2: RPB_2648Help
Entry
RPB_2648          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF177
Motif
Other DBs
NCBI-ProteinID: ABD07350
UniProt: Q2IWR0
Position
3027399..3027962
Genome map
AA seq 187 aa AA seqDB search
MSGDNPWRVPIGVMQIPETGLHRDIEAGEAERTAMAALGGLREILSAKAAFDLTPESGGR
VRVTGRVQARVGQTCVVTLDPIESAIDEDVDLTFMPAEQIRELSETVDDDGEPDPGDPPE
AIERGMIDIGRVAADALFLGIDPYPRKPDAVFEPVVEPDPPEEHPFAALQALKAPATPPR
SRKPKGD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgacaatccctggcgcgtgccgattggggtgatgcagatccccgagacgggg
ctgcatcgtgacatcgaggccggcgaggccgaacggaccgcaatggccgctctcggtggg
ctgcgcgagatcctgtcggcgaaggccgcattcgacctgacgccggaaagcggcggccgg
gtgcgcgtcaccggccgggtgcaggccagggtcggccagacctgtgtggtgacgctcgat
ccgatcgaaagcgcgatcgacgaggatgtcgacctgaccttcatgccggcggagcagatt
cgcgaattgtctgagacggtcgacgacgacggcgagcccgatccgggcgatccgccggag
gcgatcgagcgcggcatgatcgatattggccgggtcgcggccgacgcgctgtttctcggc
atcgatccgtatccgcgcaagcccgatgcggtgttcgagccggtggtcgagcctgatccc
cccgaagaacatccgtttgcggcgctgcaggcgttgaaagctccggccacaccgccgcgg
tcacgcaaacccaagggcgattag

DBGET integrated database retrieval system