KEGG   Rhodopseudomonas palustris HaA2: RPB_2661Help
Entry
RPB_2661          CDS       T00321                                 

Definition
(GenBank) Lipopolysaccharide biosynthesis
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR FAM76 BST2 Not3
Motif
Other DBs
NCBI-ProteinID: ABD07363
UniProt: Q2IWP7
Position
3043165..3045486
Genome map
AA seq 773 aa AA seqDB search
MRFAFWRRTKGETTSNEPASPAHPAAATASKAERIKAAAKQPVFNKSSPDEPVIVRRTPA
PIEPPTNGDIDLRLIGQALARKKHLIIAPTLLALVLSLAIVNLITPRYKSEARILIDGRE
NIFLRPTGERDEQRNAVDPEAVTSQVQLLLSRELALEVIKQNKLAERPEFDPVLKGINPL
KSLLAMVGIGRDPFSMTPEERVLDAYYERLTAYAVDKSRVMVVEFQSQDPELAARVANSI
ADDYLVLQQNARQAQARSAGQWLSGEIESLRKKVAEAESKAEDFRSKSSLFIGTNNTTLS
NQQLGELNTQLGNARALKSDAESKSRLIKEMLQGGRPIEVSDVLNSDVMRRLSEQRVMLR
TQLAEQSSTLLDNHPRIKELRAQLADLDRQLRDEAMKLSRSFESDARIASGRVDSLIASL
EQLKKQASSTNGQDVELRALEREAKAQRDLLESYLAKYREATTRETIDQAPADGRIISRA
IVSNTPAYPKKLPIVLIATLATLILTAGGIATGELLRMTQPRAAGLAIPAAEPARTPAAM
QAPMFVTPAAAASPPMAPARAGTGEPAAERAADADDIEALAHRLRSGGEAARKLTVLGTG
DTADVTATALSLARLLSRDARVVLVDLSESSAMLKAASADPAAPGLAELMQGEASFGQVI
TRDRSTALHLVSAGRPGFDRNLLQSPRLVVALNALLRVYDHVLLDAGTAADLPAEMLTAQ
ARAVVVPASDMPADARLKMADQLRAVGFSEATMVRAAARPSGRIEPGARTVAA
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcgcgttctggcgtcggacgaagggcgagacgacgagcaatgaaccggcttcg
cccgcgcatccggccgccgctacggcctcgaaggcagagcgtatcaaggccgcggcgaag
cagccggtcttcaacaagtcttcgcccgacgagccggtcatcgtgcggaggacgccggcg
ccgatcgagcccccgaccaacggcgatatcgacctgcggctgatcgggcaggcgctggcg
cgcaagaagcacctgatcatcgcaccgacattgctggcgctggtgctgtcgctcgccatc
gtcaatctgatcacgccgcgttacaaatctgaagcccgcatcctgatcgacggccgcgaa
aacatcttcctgcgcccgaccggcgaacgcgacgagcaacgcaatgcggtcgatccggaa
gcagtcaccagccaggtgcagttgctgctgtcgcgcgagctcgcgctcgaagtcatcaag
cagaacaagctggccgagcgtcccgaattcgatcccgtcctgaagggcatcaacccgctg
aagtctcttttggcgatggtcggtatcggccgcgatccgttctccatgacgccggaagag
cgcgttctcgacgcgtattacgagcggctcaccgcctatgcggtcgacaagtcgcgcgtg
atggtcgtcgaattccagtcgcaggatcccgagctcgcggcgcgcgtcgccaattccatc
gccgacgactatctggtgctgcagcagaacgcgcgccaggcgcaggcgcggtccgcgggg
caatggctgtccggcgagatcgaatcgttgcgcaagaaggtcgccgaggccgaatccaag
gccgaggatttccgatcgaaatcgagtctgttcatcgggaccaacaacaccacgctgtcg
aaccagcagctcggcgagctcaacacccagctcggcaatgcgcgcgccctgaaatccgac
gccgagtccaaatcacggctgatcaaggagatgctgcagggcggtcgtccgatcgaagtg
tcggacgtgctgaactccgatgtgatgcggcgattgtcggagcagcgtgtgatgctgcgc
acgcagctcgccgaacaatcgtcgacgctgctcgacaatcacccgcggatcaaggagctg
agggcgcagctcgccgatctcgaccggcaattgcgcgacgaggcgatgaagctgtcgcgt
tcgttcgagagcgacgcgcggatcgcgagcggacgggtcgacagcctgatcgccagtctc
gagcagctgaagaaacaggcgtcttcgaccaatggtcaggacgtcgaactgcgcgcgctc
gagcgcgaagccaaggcgcagcgcgatctgctggaatcctacctggcgaaataccgcgaa
gcgaccacccgagagaccatcgatcaggcgccggccgacggccgtatcatttcgcgggcc
atcgtgtcgaacacgccggcctatccgaagaagttgccgatcgtgctgatcgccacgctg
gcgacgctgatcctgaccgccggcggcatcgccaccggcgaattgctgcgaatgacccag
ccgcgcgccgccggcctcgcgattccggcggccgagccggcgcggacgcccgccgcgatg
caggcaccgatgttcgtcacgcctgccgcagcagcttcgccgccgatggcgccggcccgc
gccggcaccggcgaacccgcggccgaacgagccgccgatgcggacgacatcgaggcgttg
gcgcatcggctgcgcagcgggggcgaggctgcacgcaagctgaccgtgctcggcaccggc
gacactgccgatgtcacggcgacggctttgagcctggcgcgtctgttgtcgcgcgacgcc
agggtggtgctggtcgatctgtcggaatcctccgcgatgttgaaagcggcctcggccgat
ccggccgcgccgggactcgcggaactgatgcagggcgaagcgtcgttcggccaggtcatc
acccgcgaccgcagcacggcgctgcatctcgtcagtgcgggacggcccggcttcgatcgc
aacctgctacaatcgccgcggctggtcgtggcgctgaacgcgctgctgcgggtgtacgat
cacgtcctgctcgacgccgggaccgccgccgatctgcccgccgaaatgttgacggcgcag
gcgcgggccgtggtggtgccggcttccgacatgccggcggacgcccgtctcaagatggcg
gaccagctcagggcggtcggcttctcggaggcgacgatggtgcgcgccgcggcgcggccg
tcgggtcgcatcgagcccggcgcgcgcaccgtcgccgcgtaa

DBGET integrated database retrieval system