KEGG   Rhodopseudomonas palustris HaA2: RPB_2665Help
Entry
RPB_2665          CDS       T00321                                 

Definition
(GenBank) Cytochrome oxidase assembly
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00190  Oxidative phosphorylation
rpb00860  Porphyrin and chlorophyll metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RPB_2665
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPB_2665
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPB_2665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpb03029]
    RPB_2665
Mitochondrial biogenesis [BR:rpb03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    RPB_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX15-CtaA
Motif
Other DBs
NCBI-ProteinID: ABD07367
UniProt: Q2IWP3
Position
3048239..3049336
Genome map
AA seq 365 aa AA seqDB search
MTAAAESERLRPPRVRAVRIWLTVVAALIAVMVLVGGATRLTESGLSIVEWKPVTGTLPP
LTDAQWHAAFEGYKTIPQYRELNAGMTLYEFKTIFWWEWSHRLLGRVIGIAYLLPFLWFL
WRGAIGPQWKRALWGIFALGALQGAVGWWMVASGLSQRTEVSQVRLAVHLTLALIIYAAI
VWTLRRLADKPPIPAAARLKVTAIALLALTLLQLFLGALVAGLRAGRVFNTWPLIDGALI
PSAERLWFEQPWWKNLFDNHLTVQFDHRMMAYALWALAAWHAIDAVRSRAGGAASGALWL
FAALSLQAVLGILTVLHATPIGLALAHQAVGIVVLTLAVLQVERLTAPRLKALPRAMPVP
VGQPG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgccgcggagtccgagcgtttgcgtccgccccgcgttcgtgcggtccggatc
tggctgaccgtcgtcgctgcactgattgcggtgatggtgctggtcggcggcgcgacgcgt
ctgaccgaatccgggctgtcgatcgtcgaatggaagccggtcaccggcacgttgccgccg
ctcaccgacgcgcagtggcatgcggcgttcgagggctacaagaccatcccgcaatatcgc
gaactcaacgccgggatgacgctgtatgaattcaagacgatcttctggtgggaatggagc
caccgcctgctcgggcgggtgatcggcatcgcctatctgctgccgttcctgtggttcctg
tggcgtggcgcgatcggcccgcaatggaagcgggcgttgtggggcattttcgcgctcggc
gcgctgcagggcgcggtcggctggtggatggtggcgtcgggactgtcgcaacgcaccgaa
gtgtcgcaggtgcggctggcggtccatctgacgctggcgctgatcatctacgccgcgatc
gtctggacactgcggcggctcgcggacaagccgccgatcccggctgcggcgcgtctgaaa
gtcaccgcgatcgcgttgctggcgctgacgctgctgcagctgtttctcggcgcgctggtc
gccgggctgcgcgccgggcgggtgttcaacacctggccgctgatcgacggcgcgctgatc
ccctccgccgagcggctgtggttcgagcagccatggtggaagaacctgttcgacaatcac
ctcaccgtgcagttcgaccatcgcatgatggcctatgcgctgtgggcgctggcggcctgg
cacgcgatcgacgcggtgcggtcgcgcgcgggtggcgcggcctcgggagcgctgtggctg
ttcgcggcgctgtcgctgcaggcggtgctgggcattctgacggtgctgcatgcgactccg
atcggcctggcgttggcgcatcaggcggtcggcatcgtcgtgctgacgctggcggtgctg
caggtcgaacggctgacggcgccgcggctgaaagcgctgccgcgggcgatgccggtgccg
gtcggtcagccgggctga

DBGET integrated database retrieval system