KEGG   Rhodopseudomonas palustris HaA2: RPB_2679Help
Entry
RPB_2679          CDS       T00321                                 

Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00240  Pyrimidine metabolism
rpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RPB_2679
Enzymes [BR:rpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     RPB_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 AAA_33 AAA_22 AAA_16 AAA_30 TsaE
Motif
Other DBs
NCBI-ProteinID: ABD07381
UniProt: Q2IWM9
Position
3061096..3061836
Genome map
AA seq 246 aa AA seqDB search
MLEQTTQTASACGHFITFEGGEGAGKSTQIRLLAQRLEKAGLETLVTREPGGSPGAEIIR
HLLLAGVGRAIGGAEAEALLFAAARDDHVRTLIQPALDRGVWVLCDRFYDSTRVYQGRLG
DVSPGMLNALQDVTIGTMKPDLTVILDVPVEIGLARAAVRRGSDAPDRFESENIDFHRRL
RDAYRQIARAEPERCVLVDAHAEPKVVADRIWLTVQERLLQWPQAKPAVTPKAKAKTKTK
TKARSA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacagacaacccaaactgcctcagcttgcggccatttcatcactttcgaaggg
ggcgagggggccggcaaatcaacccagatcaggctgctggcgcagcggctggaaaaggcc
gggctggagaccctggtgacgcgcgagccgggcggctcgccgggtgcagagatcatccgg
catctgttgctggccggcgtcggccgggcgatcggcggtgctgaggctgaggcgctgctg
ttcgccgcggcccgcgacgaccatgtccgcacattgatccagcccgcattggatcgcggc
gtctgggtgctgtgcgaccggttctatgattcgaccagggtctaccagggtcggctcggc
gacgtcagccctgggatgctgaacgctttgcaggacgtcaccatcggcaccatgaagccc
gacctcaccgtgatcctcgacgtgccggtcgaaatcgggctggcgcgcgccgcagtgcgt
cgcggcagcgatgcgcccgaccgattcgaatccgagaacatcgattttcatcgccggttg
cgcgacgcctatcggcagatcgcgcgcgccgagccggagcgctgtgtgctggtcgatgcg
catgccgaaccgaaggtcgtggccgatcggatctggctgacggtgcaggagcggctgctg
cagtggccgcaggccaaacccgcggtgacgccgaaggcgaaagctaagacgaaaacgaag
accaaggcgcgatcggcatga

DBGET integrated database retrieval system