KEGG   Rhodopseudomonas palustris HaA2: RPB_2681Help
Entry
RPB_2681          CDS       T00321                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00450  Selenocompound metabolism
rpb00970  Aminoacyl-tRNA biosynthesis
Module
rpb_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RPB_2681
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPB_2681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpb01007]
    RPB_2681
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpb03016]
    RPB_2681
Enzymes [BR:rpb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RPB_2681
Amino acid related enzymes [BR:rpb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RPB_2681
Transfer RNA biogenesis [BR:rpb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPB_2681
 Prokaryotic Type
   Other AARSs
    RPB_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABD07383
UniProt: Q2IWM7
Position
3062953..3064497
Genome map
AA seq 514 aa AA seqDB search
MAQRNSFYITTAISYPNGAPHIGHAYEAIATDALARFQRLDGRDVFFLTGTDEHGLKMIQ
TAQKEGVETHVLAARNAGRFRDMDDRFGISYDRFIRTSEEQHHRSVQEVWKRMQANGDIY
LDSYAGWYSVRDEAYYAEDETVVGEDQIRRGPQGTPVEWVEERSYFFKLSAYQDKLLKLY
EDQPDFIGPDSRRNEVISFVKGGLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYIT
GVGFPDESDANWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPIQKRVYAHGFLFNKGE
KMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGADGSYNHEAIVNRINADLANDLGNL
AQRSLTMVAKQCDAQVPQHGEFSEADKAMLAMADGMIAIARPAMATQQIHQALNAVWAVV
AEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQVGILAQPAIPASAAKLLDILGVAE
GARDFAALPTRIVPGTPLPAPAPIFPRYVEPATA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgaaactcgttctacatcaccaccgcaatctcctatcccaacggcgcgccg
catatcggccacgcctatgaggcgatcgcgaccgacgcgctggcgcgattccagcggctc
gacggccgtgacgtgttcttcctgaccggcaccgacgagcacggcctgaagatgatccag
accgcgcagaaggagggcgtcgagacccacgtgctcgccgcccgcaatgccggccgcttc
cgcgacatggacgaccgcttcggcatctcctacgaccgcttcatccgcacctcggaagag
cagcatcatcgctccgtccaggaggtctggaagcggatgcaggcgaacggcgacatctat
ctcgacagctatgccggctggtattcggtccgcgacgaggcctattacgccgaggacgaa
accgtcgtcggcgaggatcagattcgccgcggcccgcagggcacgccggtcgaatgggtc
gaggagcggagctacttcttcaagctctcggcctatcaggacaaactcctgaagctgtac
gaggaccagccggacttcatcggcccggattcccgccgcaacgaggtgatcagcttcgtc
aagggcgggctgaaggacctgtcggtgtcgcgcaccaccttcgactggggcgtcaaggtg
ccgggcgatccggagcacgtgatgtatgtctgggtcgatgcgctgaccaactacatcacc
ggcgtcggcttccccgacgagagcgacgccaactggcattattggccggccgacgtgcac
gtcatcggcaaggacatcatccgcttccacgcggtgtactggccggcgttcctgatgtcg
gccggcatcccgatccagaagcgcgtctacgcccacggctttttgttcaacaagggcgag
aagatgtcgaaatcggtcggcaatatcgtcgacccgttcaatctcgccgatcaatacggc
gtcgatcaggtgcgctacttcttcctgcgcgaggtgccgttcggcgccgacggcagctat
aatcacgaggcgatcgtcaatcgcatcaacgccgacctcgccaacgacctcggcaatctg
gcgcagcgctcgctgaccatggtggccaagcagtgcgacgcccaggtgccgcagcacggc
gagttcagcgaggccgacaaggcgatgctggcgatggccgacggcatgatcgcgatcgca
cgcccggcgatggcaacgcagcagatccatcaggcgctgaacgcggtgtgggcggtggtg
gcggaagccaaccgttacttcgccggcgaagcgccgtgggcgctggccaagaccgatccg
gcgcggcagaagacggtgctctacgtcaccgccgaagtgctgcggcaggtcggcatcctg
gcgcagcccgcgatcccggcctcggcggccaagctgctcgacatcctcggcgtcgccgag
ggcgcgcgcgacttcgcggcgctgccgacgcggatcgtgccgggcacgccactgccggcc
ccggcgcctatcttcccgcgctatgtcgagccggcgaccgcctga

DBGET integrated database retrieval system