KEGG   Rhodopseudomonas palustris HaA2: RPB_2688Help
Entry
RPB_2688          CDS       T00321                                 

Definition
(GenBank) Undecaprenyl pyrophosphate synthetase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00900  Terpenoid backbone biosynthesis
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPB_2688
Enzymes [BR:rpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     RPB_2688
Prenyltransferases [BR:rpb01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   RPB_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: ABD07390
UniProt: Q2IWM0
Position
complement(3072897..3073616)
Genome map
AA seq 239 aa AA seqDB search
MQSNLHSKLHVGIIMDGNGRWATRRGLSRLRGHQAGVEAIRRVMEAAPEQGIGTLTLFAF
SSDNWRRPRSEVSALMGLFRSYLVNEVKGLVDNGIRLTLIGRRDRLPDGLAETIERAEAA
TAAGDALALRIAVDYSARDTIVNAAVRAGGLQSCSRETFSDLITGSKLRDVDLIIRTSGE
RRLSDFLLWESAYAELYFTDRMWPDFDANDLADAMASFHGRERRFGGLPSMKPDVSISA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcaatctacattccaaactacatgtcggcatcatcatggacggcaacgggcga
tgggcgacgaggcgagggttgtcacgcctgcgcgggcatcaggccggtgtcgaggcgatc
cgccgcgtgatggaagctgcgccggagcagggcatcggaacgctgacgctgttcgcgttc
tccagcgacaattggcgacgcccgagatccgaggtctcggcgctgatggggctttttcgc
tcgtacctggtgaacgaggtgaagggcctcgtcgacaacggaatccgcctcacgttgatc
ggacgtcgcgaccgcctcccggatggcctcgccgaaacgatcgaacgtgccgaagccgcg
accgctgcaggcgacgcgctcgccttgcgtatcgcggtcgactactcggctcgggatacg
attgtcaacgccgctgtgcgcgccggcggactgcagagttgcagccgcgagacgttttcc
gacctcatcaccggatcgaagctgcgcgacgtcgacctcatcatccgcaccagcggcgaa
cgccgactgtccgatttcctgctttgggaaagcgcctacgccgaattgtacttcaccgac
cggatgtggccggacttcgatgccaacgatctcgccgacgccatggcgtcgttccatggc
cgtgagcgccggttcggcggcctgccatcgatgaaaccggacgtctccatcagcgcctag

DBGET integrated database retrieval system