KEGG   Rhodopseudomonas palustris HaA2: RPB_2689Help
Entry
RPB_2689          CDS       T00321                                 

Definition
(GenBank) putative transcriptional regulator
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_34 HTH_20 MarR_2 HTH_5 HTH_IclR HTH_24 DUF2513 HxlR Rrf2 ZFYVE21_C
Motif
Other DBs
NCBI-ProteinID: ABD07391
UniProt: Q2IWL9
Position
complement(3073667..3074047)
Genome map
AA seq 126 aa AA seqDB search
MPKPDTNAAPFSYEGLDRVIHEKARLGMLTSLMAHPKGLAFADLKRLCGLTDGNLSRHLQ
VLQEAGMVEVSKGYEANRPLTTCRLTKTGRRQFLDYLTVLEQLVRDAAKAAGSSDPLPTG
LHTRPV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcctgacacgaacgctgcaccgttctcctacgaggggctggatcgcgtgatc
cacgagaaggcgaggctggggatgctgacctcgctgatggcgcacccgaaggggcttgcg
ttcgccgacctcaaaaggctatgcggactgacggacggcaatctcagccggcatcttcag
gtgctgcaggaagccggaatggtcgaggtgtcgaagggatacgaagccaaccggccgctg
acgacctgtcgtttgacgaagaccggccgccgccagtttctcgattacctcaccgtgttg
gagcagctcgtgcgcgacgccgccaaggcggccggcagtagcgatccgctgccgaccgga
cttcacacgcgtcccgtctga

DBGET integrated database retrieval system