KEGG   Rhodopseudomonas palustris HaA2: RPB_2692Help
Entry
RPB_2692          CDS       T00321                                 

Definition
(GenBank) hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbiEii 3-alpha
Motif
Other DBs
NCBI-ProteinID: ABD07394
UniProt: Q2IWL6
Position
complement(3076487..3077146)
Genome map
AA seq 219 aa AA seqDB search
MQKALVALDSLPGAPAIWTFGGGTALAQILDHRISYDVDIFLDSSTALKNLAPNVNPVTK
SLCDTWNWPGKYLKLILRNVGEIDFLNAPSYIDRPTYELRFGERIISAERVAETATKKLK
YRASQYTPRDAFDLAAIYLHDREALREVAQCPAISDAEVAAALNRMNLVKDDYQAEMRNV
INPTARGEEFIDRTCEIALEALVELRTLIPQNETGHGPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagccctggtcgcgctcgatagcctgcccggcgcaccagccatatggacgttc
ggcggcggtacggcgttggcgcaaatcctggatcaccgcatcagctacgacgtggatatc
tttctcgattccagcaccgcgttgaagaatctggccccgaacgtgaaccccgtgaccaaa
tcgctgtgcgacacctggaattggcctggcaagtatctcaaactcatccttcgtaacgtc
ggtgagatcgatttcttgaatgcgccgtcctacatcgatcggccgacctacgaacttcgt
tttggagagcgtatcatctctgccgagagagtggccgagaccgcgaccaagaaactgaag
taccgcgcctcacagtacacgccgcgggatgcatttgatttggccgccatctatctgcat
gaccgggaggccttacgcgaggttgcgcaatgtcccgcaatctcggacgccgaggtggcc
gcggcactcaaccgaatgaatctggtgaaagacgactatcaggccgaaatgcgcaacgtg
atcaaccccacggctcgtggcgaggaattcatcgaccggacttgcgagatcgcgcttgaa
gcgctcgtggagttgagaacgttgattccgcaaaacgaaaccggccatgggccacgctag

DBGET integrated database retrieval system