KEGG   Rhodopseudomonas palustris HaA2: RPB_2697Help
Entry
RPB_2697          CDS       T00321                                 

Definition
(GenBank) transport system permease protein
  KO
K02015  iron complex transport system permease protein
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb02010  ABC transporters
Module
rpb_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RPB_2697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpb02000]
    RPB_2697
Transporters [BR:rpb02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    RPB_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: ABD07399
UniProt: Q2IWL1
Position
3082597..3083655
Genome map
AA seq 352 aa AA seqDB search
MTDLTAVARSAVAGHLRQTRRRAAIVIGLLIAAALALQLDIGTGPSALTTMDLLRGLFDP
SSLSRSSAVIVWEIRLPQALMAALVGAALAVAGAELQTILANPLASPFTLGMSSAATFGA
AVAIVLGIGIPGVPRIGIISTNAFVFAFGSALLIQLLGRLRGTDGQTHVLFGIALFFTFN
ALVAIMQFIATEQALQQLVFWTLGSVTRANMESVAILAVVLLLVFPLAMASSWQLTALRL
GQERASSFGVNVRNLKLFALLRVSALTGAAVAFVGTIAFIGLVGPHIARLLVGEDHRFFL
PASACAGAVVMSLASCASKLVIPGIVLPIGLVTSLIGVPFFLALILIRKDRG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcaccgccgtcgcccgatccgccgtcgccggacatctgcggcagacccga
cggcgcgcggcgatcgtgattgggctgctgatcgcggccgcgctggcgctgcagctcgac
atcggcaccgggccgtcggcgctcacgacgatggatctgctgcgcgggctgttcgatccg
tcgagcctcagccggtcatcggcggtgatcgtctgggagatccggttgccgcaggcgctg
atggcggcgctggtcggcgcggcgctggcggtcgccggcgcggagctgcagactattctc
gccaacccgctggccagcccgttcacgctcggcatgtcgtcggcggcgacgttcggcgcg
gcggtcgcaatcgtgctcggcatcggcattccgggcgtcccccgcatcggcatcatttcc
accaatgcgttcgtgttcgcgttcggctcggcgttgctcatccagttgctcggccggctg
cgcggcaccgacgggcagacccatgtgctgttcggcatcgcgctgttcttcaccttcaat
gcgctggtcgcgatcatgcaattcatcgccaccgaacaggctctgcagcaattggtgttc
tggacgctgggcagcgtcacccgcgccaacatggagagcgtcgcgatcctggcggtcgtg
ctgttgctggtgtttccgctggcgatggcgtcgtcgtggcagctcaccgcgctgcggctc
ggacaggagcgcgcctcgagcttcggcgtcaatgtccgtaacctgaaactgttcgcgctg
ctgcgggtgagcgcactcaccggcgccgccgtagcgtttgtcggcaccatcgccttcatc
ggactggtcgggccgcatatcgcgcggctgctggtcggcgaggatcatcgtttctttctg
ccggccagcgcctgcgccggcgcggtggtgatgtcgctggcgtcgtgcgcttcgaagctg
gtgatccccggcatcgtgctgccgatcggtctggtcacctcgctgatcggcgtgccgttc
tttctggcgttgatcctgatccggaaggaccgcggatga

DBGET integrated database retrieval system