KEGG   Rhodopseudomonas palustris HaA2: RPB_2715Help
Entry
RPB_2715          CDS       T00321                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    RPB_2715
DNA repair and recombination proteins [BR:rpb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     RPB_2715
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      RPB_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_29 AAA_16 AAA_25 AAA_21 BCA_ABC_TP_C DnaJ_CXXCXGXG RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABD07417
UniProt: Q2IWJ3
Position
3099548..3102583
Genome map
AA seq 1011 aa AA seqDB search
MDEVIKAKRQPPQRPSVASSRTAITIRGAREHNLKNVDVVIPRDKLAVFTGLSGSGKSSL
AFDTIYAEGQRRYVESLSAYARQFLEMMQKPDVDQIDGLSPAISIEQKTTSKNPRSTVGT
VTEIYDYMRLLWARVGVPYSPATGLPIESQTVSQMVDRVLALPEGTRLYLLAPVVRGRKG
EYRKELADWLKKGFQRVKIDGAFHELAEAPVLDKKFPHDIDVVVDRIVVRPDIGQRLAES
FETALKLAEGLAVIEYADAPATPPAAAVEPGPDEPGDKKKKADKKVAKIHDKTGAERILF
SEKFACPVSGFTIPEIEPRLFSFNNPYGACPECGGLGIEQHIDADLVVPDKELTLRKGAI
APWAKSSSPYYLQTLTALAKFYKFTLDTKWKDLPKKVQTALLFGSGDDEIKFSYEDGVRS
YDTKKPFEGVVTNIERRFRETESEWAREELGKYFSDVPCEACHGHRLKPEALCVKIGGKH
IGNISELSVKAAGEWFEAVPASLNTQQNEIAVRILKEIRDRLSFLLDVGLNYLTLARAAG
TLSGGESQRIRLASQIGSGLTGVLYVLDEPSIGLHQRDNARLLDTLKRLRDLGNTVIVVE
HDEDAIRLADFVLDIGPGAGVHGGHIVAQGTPDEVMANPKSLTGKYLTGELSVPIPERRP
PNHRRTLKLVNARGNNLKNVTAEIPLGLFTCVTGVSGGGKSTLLIDTFYKAIARKLNNAS
EPPAPHDRIEGLEHIDKIIDIDQSPIGRTPRSNPATYTGAFTPIREWFAGLPESKARGYE
PGRFSFNVKGGRCEACQGDGVIKIEMHFLPDVYVTCDVCKGKRYNRETLEVLFKGKSIAD
VLDMTVEEAADFFKAVPRVRETFKTLHRVGLDYIHVGQQATTLSGGEAQRVKLAKELSKR
ATGRTLYILDEPTTGLHFHDVAKLLEVLHELVAQGNTVVVIEHNLEVIKTADWVIDLGPE
GGDGGGEIVAWGPPEDIVKAPRSYTGKFLKPVLEKKGPAKATKRKTDEAAE
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagtgatcaaggcgaagcgccagccgccgcaacggccgtcggtggcttcgagc
cggaccgccatcaccattcgcggcgcccgcgagcacaatctcaagaacgtcgacgtcgtc
atcccgcgcgacaagctcgcggtgttcaccggcctgtccggctccggcaaatcctcgctg
gcgttcgacaccatctatgccgagggccagcgccgctacgtcgaatcgctgtcggcctat
gcgcggcagttcctcgagatgatgcagaagccggacgtcgatcagatcgacgggctgtcg
ccggcgatctcgatcgagcagaagaccacctcgaagaacccgcgctccacggtcggcacc
gtcaccgagatctacgactacatgcgcctgttgtgggcccgcgtcggcgtgccctattcg
cccgcgaccgggctgccgatcgagagccagaccgtgtcgcagatggtcgaccgggtgctg
gcgctgccggagggcacgcggctgtatctgctggcgccggtggtgcgcggccgcaagggc
gagtaccgcaaggaactcgccgactggctcaagaaaggcttccagcgcgtcaagatcgac
ggcgccttccacgagctcgccgaagcgccggtgctcgacaagaaattcccgcacgacatc
gacgtcgtggtcgaccgcatcgtggtccgccccgacatcggccagcgcctcgccgagagt
tttgaaaccgcgctgaagctcgccgaagggctggcggtgatcgaatatgccgacgcgccc
gccacgccgccggcggcagccgtcgagcccggtccggacgagcccggcgacaagaagaaa
aaggccgacaagaaggtcgccaagatccacgacaagaccggcgccgagcgcatcctgttc
tcggagaaattcgcctgcccggtgtccggcttcaccattccggaaatcgagccgcgcctg
ttctcgttcaacaatccctacggcgcctgcccggaatgcggcgggctcggcatcgagcag
catatcgacgccgatttggtcgtgcccgacaaggagctgacgctgcgcaagggcgcgatt
gcgccgtgggcgaaatcatcctcgccctactatctgcagacgctgaccgcgctggcgaag
ttctacaaattcacgctcgacaccaaatggaaggacctgccgaagaaggtccagaccgcg
ctgctgttcggctccggcgacgacgagatcaaattctcttatgaagacggggtgcgctcc
tacgacaccaagaagccgttcgagggcgtggtgaccaatatcgagcgccgcttccgcgag
accgagagcgagtgggcgcgcgaggagctcgggaagtacttctccgacgtgccttgcgag
gcctgccacggccatcgcctcaagcccgaggcgctgtgcgtcaagatcggcggcaagcac
atcggaaacatctccgaactctccgtgaaagccgccggcgaatggttcgaggcggtgccg
gcatcgctcaacacccagcagaacgagatcgccgtccgcatcctcaaggagatccgcgac
cggctgagcttcctgctcgacgtcggcctcaactatctgacgctggcgcgcgccgccggc
acgctgtcgggcggcgaaagccagcgcatccggctcgcctcgcagatcggaagcggcctc
accggcgtgctctacgtgctcgacgagccgtcgatcggcctgcaccagcgcgacaacgcc
cgcctgctcgacaccctgaaacgactccgcgacctcggcaacaccgtgatcgtggtcgag
catgacgaggacgcgatcaggctggccgatttcgtgctcgatatcggccccggcgccggc
gtccatggcggccacatcgtggcgcagggcacgcccgacgaggtgatggccaatccgaaa
tcgctgaccggcaaatatctcaccggcgaattgtcggtgccgattccggagcgccggccg
ccgaaccatcgccgcaccctcaagctggtcaacgcccgcggcaacaatctcaaaaacgtc
accgccgaaattccgctcggcctgttcacctgcgtcaccggcgtctccggcggcggcaag
tcgacgctgctgatcgatacgttctacaaggcgatcgcccgcaagctgaacaacgcctcc
gagccgccggcgccgcacgaccgcatcgagggcctcgagcacatcgacaagatcatcgac
atcgaccagtcgccgatcggccgcaccccgcgctccaatcctgcgacctacaccggcgcg
ttcacgccgatccgcgaatggttcgccggcctgcccgagtccaaggcgcgcggctacgag
ccgggccgcttctccttcaacgtcaagggcggccgctgcgaggcctgccagggcgacggc
gtcatcaagatcgagatgcactttttgcccgacgtctacgtcacctgcgatgtctgcaag
ggcaagcgctacaaccgcgaaacgctcgaagtgctgttcaagggcaagtcgatcgccgac
gtgctcgacatgacggtcgaggaagccgccgacttcttcaaggcggtgccgcgcgtccgc
gagaccttcaagaccctgcaccgcgtcggcctcgactacatccatgtcggccagcaggcg
acgacgctctccggcggcgaagcccagcgcgtcaagctcgccaaggaactgagcaagcgc
gccaccggccgcacgctttatattttggacgagcccaccaccggcctgcacttccacgac
gtcgccaaactgctcgaagtgctgcacgagctggtggcgcagggcaataccgtggtggtg
atcgagcacaatctcgaagtcatcaagaccgccgactgggtcatcgacctcggccccgaa
ggcggcgacggcggcggcgaaatcgtcgcctggggcccgccggaagacatcgtcaaggca
ccgcggagctacaccgggaagttcctgaagccggtgctggagaagaaggggccggcgaag
gcgacgaagcggaagacggacgaggcggcggagtaa

DBGET integrated database retrieval system