KEGG   Rhodopseudomonas palustris HaA2: RPB_2716Help
Entry
RPB_2716          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD07418
UniProt: Q2IWJ2
Position
complement(3102645..3103892)
Genome map
AA seq 415 aa AA seqDB search
MVAKPYTWKDGATLEEHSRRKHQIIRQYFARYIRVRCQLPQQSKFRFAIVDGFAGGGVYN
CGASGSPLIFIEELRATSIELNLRRANEGMSPLDIECVLIFNDFDPGAIEILKQHVAPLL
AGIKESEPRLHLEVHYRQQEFENVYAEIREFLQYNRVQSVLFNLDQCGNSRVAHETLTDI
IASFSSPEIFYTFAIEALISFLKKTDPNALNARLNPIGVDADSVSNLGLMMNNQAWLGAT
ERLVFEAFERCASYVSPFSIHNPNGWNYWMLHFAKSHRARQEYNDVLHDNASTLAHYGRS
GLHMLAYDPQHEGGLYLFDMKGRDSAKSQLHGDIPRLVSEFGDAVSVADFYASIYTATPA
HTQDIHGVMIENPDLQVVTARGGDRGAPHTIRPTDTLRLRQQRSFSFSTPPSKRR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaagccttacacgtggaaagatggcgcgacgttagaagaacattcgcgccgc
aagcaccaaatcatccgacagtactttgcccgttacattagggtccgttgccagcttccg
cagcaatcaaagttccgatttgcaatagttgatggattcgctggcggcggcgtctacaat
tgtggcgcatcgggatcgccgttgatcttcattgaggaattgcgtgccacttcaatcgaa
ctgaacctgagacgcgctaatgaaggcatgtcgccattagatatagaatgtgtactaatc
ttcaacgatttcgatcccggcgctattgaaatcctaaagcagcacgtcgcgcctctgctc
gccgggattaaggaaagtgagccacgtcttcatcttgaagttcactaccggcagcaggaa
ttcgaaaacgtctacgccgagatacgtgagtttctgcaatacaatcgagtgcaaagcgtt
ctgtttaatctggatcagtgcggcaacagtcgcgtagcgcacgaaacgcttaccgacata
atcgcgtcgttttcgtcacctgagattttctacactttcgccattgaggccttgatttcg
ttcttgaaaaagactgatccaaatgctttgaacgcacgcctaaatccgattggagttgac
gcggacagcgtgtcaaatctcgggctaatgatgaacaatcaagcgtggcttggcgctact
gagcggcttgtgtttgaagcgttcgagcgatgcgccagctatgttagcccgttttctatt
cacaatccgaacggatggaactactggatgttgcactttgcaaagtcgcatcgcgcgcga
caggagtacaacgacgtactgcacgacaacgccagcacgttagcgcactacgggcggtct
ggcctacatatgttggcttacgatccgcaacacgaaggcggcctgtacctattcgacatg
aaaggccgcgacagcgccaaatcgcaattgcacggtgacattccccgccttgtatccgag
ttcggcgacgctgtatctgttgctgacttttacgccagcatctatacggctacgccggcg
cacacgcaggatattcatggcgtgatgatcgaaaatccggacctgcaagtggtcacggca
cgcggcggcgatcggggggcgccgcacaccattcgtcctaccgacacattgcggcttcga
cagcagcgcagcttttcgttttcaacgccgccatcgaaacgtcgctga

DBGET integrated database retrieval system