KEGG   Rhodopseudomonas palustris HaA2: RPB_2722Help
Entry
RPB_2722          CDS       T00321                                 

Definition
(GenBank) Twin-arginine translocation pathway signal
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3828 SnoaL_4
Motif
Other DBs
NCBI-ProteinID: ABD07424
UniProt: Q2IWI6
Position
3106750..3107265
Genome map
AA seq 171 aa AA seqDB search
MLSRRTFLIATASLAVPAAALAQATPPAKPPANDPTALLTRLYTASSPGGSDLVNSPKSR
AKILSKSFAALWTRAEARTKDDIGPVDFDPVSNSQDPDIKAFAIKVEKEDDASATLAVTL
TGSQPRDKAEDGVIRYDFVRDGGHWRIDDIRGAVDGEAWSVRKLLADSLKR
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccgccgcacgttcctgatcgccaccgcttccctcgccgttcccgccgccgcg
ctggcgcaggccacgccgccggccaagccgccggcgaatgatccgacggcgctgctgacg
aggctctacaccgcctcctcccccggcggcagcgatctggtcaacagcccgaagagtcgc
gcgaagattctgtcgaaatccttcgccgcgctgtggaccagggccgaggcgagaacgaag
gacgacatcgggccggtcgatttcgatccggtgagcaattcgcaggaccccgacatcaag
gcgttcgccatcaaggtcgagaaagaggacgacgccagcgcgacgctcgccgtcaccctc
accggcagccagccgcgcgacaaggcggaggacggcgtgatccgctacgacttcgtccgc
gacggcggccactggcggatcgacgacatccgcggcgcggtcgacggcgaagcgtggtcg
gtgcgcaaattgctggccgactcgctcaagcgctga

DBGET integrated database retrieval system