KEGG   Rhodopseudomonas palustris HaA2: RPB_2725Help
Entry
RPB_2725          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3597
Motif
Other DBs
NCBI-ProteinID: ABD07427
UniProt: Q2IWI3
Position
complement(3108961..3109344)
Genome map
AA seq 127 aa AA seqDB search
MSIFGKIMGAIFGSSADAAPGGSAGTSTAAPGTAPAPGSSGATVDVAPILDQAVKAKGEK
LEWRTSIVDLMKALDIDSSLSARKELAKELGYTGDTGDSASMNIWLHKQVMAKLAANGGK
VPDDLKD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttcggcaagatcatgggcgcgattttcggcagcagcgcggacgccgcgccg
ggcggcagcgcaggtacgagcacggccgctccgggaaccgcgccggcgccggggagttcg
ggtgcaaccgtcgatgtcgccccgatcctcgaccaggccgtgaaggccaagggcgagaag
ctggagtggcgcacctcgatcgtcgacctgatgaaggcgctggatatcgattccagcctg
tcggcgcgcaaggagctcgccaaggagctcggctacaccggcgacaccggcgacagcgcc
agcatgaacatctggctgcacaagcaggtgatggccaagctcgccgccaatggcggcaag
gtgccggacgatctgaaggattga

DBGET integrated database retrieval system