KEGG   Rhodopseudomonas palustris HaA2: RPB_2726Help
Entry
RPB_2726          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2189 GPDPase_memb
Motif
Other DBs
NCBI-ProteinID: ABD07428
UniProt: Q2IWI2
Position
3109802..3110704
Genome map
AA seq 300 aa AA seqDB search
MATIYPAEASDARPIGAAAEPSVHRIALADLHDALRRGWDDFKAVPSHAVMLCVIYPVLG
LVLARLVLGYSVLPLLFPLAAGFALIGPFAALGLYELSRRRKAGEDASAWHAVDVLRSPS
IGAMLGLGAILFAVFGVWIATAQGIYVATFGHAPAAAIPDFVTRVLTTPEGWSLIAIGCG
VGFMFAVAALCVSVVAFPMMLDRQAGVGAAVTASLRVAARNPLEIAAWGLIVAALLVLGS
LPAFLGLAVVIPLLGHATWHLYRKVIEPNPHPPQIPPPNPIKRSAADFPATLLQWKRKAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccacgatctatcctgccgaagccagtgacgcccgcccgatcggcgcggcggccgag
ccgtcggttcatcgtatcgctcttgccgacctgcacgacgcgctgcggcgcggctgggac
gacttcaaggcggtgcccagccacgccgtgatgctgtgcgtgatctatccggtgctcggc
ctggtgctggcgcggcttgtgctcggctattcggtgctgccgctgctgtttccgctcgcc
gccggcttcgcgctgatcgggccgttcgcagccctcgggctgtacgaactgagccgccga
cgcaaggccggcgaggatgcctcggcgtggcacgccgtcgacgtgctgcgttcgccgtcg
atcggggcgatgctagggctcggcgcgatcctgttcgccgtgttcggggtgtggatcgcg
accgcgcagggcatctatgtcgccaccttcggccatgcgccggcggcggcgatcccggat
ttcgtcacccgtgtgctgaccacgccggaaggctggagcctgatcgcgatcggctgcggt
gtcggcttcatgttcgcggtcgcggcgctgtgcgtcagcgtggtggcgtttccgatgatg
ctcgaccgtcaggccggggtcggcgcagcggtgacggcgtcgttgcgcgtcgccgcgcgc
aatccgctggaaatcgccgcctggggcctgatcgtggccgcgctgctggtgctgggctcg
ctgccggccttcctcggcctcgcggtggtcatcccgctgctcggccacgccacctggcat
ctctaccgcaaggtgatcgagcccaatccgcatccgccgcagattcccccgccgaacccg
atcaagcgttccgcggccgacttccccgcgacgctgctgcagtggaagcgcaaggcgggc
tag

DBGET integrated database retrieval system