KEGG   Rhodopseudomonas palustris HaA2: RPB_2727Help
Entry
RPB_2727          CDS       T00321                                 

Definition
(GenBank) Protein of unknown function DUF1127
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1127
Motif
Other DBs
NCBI-ProteinID: ABD07429
UniProt: Q2IWI1
Position
3111261..3111413
Genome map
AA seq 50 aa AA seqDB search
MLLSLIRALRAFRDYQRNLAELSQLSDRELADIGLDRSDIPRVASGHFNG
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgttgctttcgctcatccgcgccctccgggcgttccgggattatcagcgcaatctcgct
gaactctcgcagctcagtgatcgcgaactggccgatatcggactcgaccgctcggacatc
ccgcgcgtggcgtccggtcacttcaatggctga

DBGET integrated database retrieval system