KEGG   Rhodopseudomonas palustris HaA2: RPB_2729Help
Entry
RPB_2729          CDS       T00321                                 

Definition
(GenBank) phytoene synthase
  KO
K02291  15-cis-phytoene synthase [EC:2.5.1.32]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00906  Carotenoid biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    RPB_2729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rpb01006]
    RPB_2729
Enzymes [BR:rpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.32  15-cis-phytoene synthase
     RPB_2729
Prenyltransferases [BR:rpb01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   RPB_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQS_PSY
Motif
Other DBs
NCBI-ProteinID: ABD07431
UniProt: Q2IWH9
Position
complement(3113196..3114059)
Genome map
AA seq 287 aa AA seqDB search
MSGNAGDDAAAAFCAELVRSHDFDRYAATLFVEPPRRRALLALYAFNVEVVRVRDQVSQP
LPGEIRLQWWTDTLAGTAHGGIEGNPVAAELLRATGQHGLPVAALAQLIETHLFDLYNDP
MPTLTVLEAYAADTDGALFALAARILDQGSEAVDHLARHAGVAQGFARAIARLPIDAARR
QCFVPLELLAAHGSSEAEVYAGRATPALRLTLDALIAEAQRHCDAALRLLAEVPPPARRA
FLPLALAQRDLDRLAQPGTDLFAPHERSRLATLWTLWKASRTRAFRQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaacgccggcgacgacgccgccgcggcattctgcgccgaactggtgcgcagc
cacgatttcgaccgctacgccgcgacgctgttcgtcgagccgccgcgccggcgcgcgctg
ctggcgctgtacgccttcaacgtcgaggtggtgcgcgtccgcgaccaggtcagccagccg
ctgccgggcgaaatccggctgcaatggtggaccgacacgctggccggcaccgcgcatggc
ggcatcgaaggcaatccggtcgcggccgaattgttgcgcgcgaccgggcagcacgggctg
ccggtcgcggctctggcgcaactgatcgaaacgcatctgttcgacctctacaacgacccg
atgccgacgctgaccgtgctggaagcctatgcggccgataccgacggcgcgctgttcgcg
ctggcggcgcggatcctcgatcagggctcggaggcggtcgaccatctcgcccgccatgcc
ggggtggcgcagggattcgcgcgcgcgatcgcgcggctgccgatcgatgcagcgcgacgg
cagtgcttcgtcccgctcgagcttttggcggcgcacggcagcagcgaggccgaggtctat
gccggccgcgccacaccggcgctacggctgacgctcgacgcgctgatcgccgaggcgcag
cgccattgcgacgccgcgctgcggctgctcgccgaagtgccgccaccggcgcgccgcgcg
ttcctgccgctggcgctggcgcagcgcgatctcgaccggctggcgcagcccggcaccgac
ctgttcgcgccgcacgagcgctcccgtctggcgacgctgtggaccctgtggaaggcgtcg
cggacgcgggcgtttcggcaataa

DBGET integrated database retrieval system