KEGG   Rhodopseudomonas palustris HaA2: RPB_2730Help
Entry
RPB_2730          CDS       T00321                                 

Definition
(GenBank) Protein of unknown function DUF498
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF498
Motif
Other DBs
NCBI-ProteinID: ABD07432
UniProt: Q2IWH8
Position
complement(3114056..3114439)
Genome map
AA seq 127 aa AA seqDB search
MADRPEIPHFPRTASVEAYGKGGFYFGDMSHVGSLLFLPDAVWGWDVTEPAQIDRYSLQR
VFDNANAIETLIVGTGTDVWIAPRPLREQLRAVGIVLDTMQTGPAVRTYNIMIGERRRVA
AALIAVP
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaccgcccggagatcccgcattttccgcgcacggcctcggtcgaggcctatggc
aagggcgggttctatttcggcgacatgtcgcatgtcggctcgctgctgttcctgcccgac
gcggtgtggggctgggacgtcaccgagccggcccagatcgaccgctatagcctgcagcgg
gtgttcgacaacgccaacgcgatcgagacgctgatcgtcggcaccggcaccgacgtctgg
atcgcgccgcgtccgctccgcgagcaactgcgcgccgtgggcatcgttctggatacgatg
cagaccgggccggcggtgcggacctacaacatcatgatcggcgagcgccgccgcgtcgcc
gcggcgctgatcgcggtgccatga

DBGET integrated database retrieval system