KEGG   Rhodopseudomonas palustris HaA2: RPB_2732Help
Entry
RPB_2732          CDS       T00321                                 

Definition
(GenBank) protein-export membrane protein SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb03060  Protein export
rpb03070  Bacterial secretion system
Module
rpb_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    RPB_2732
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPB_2732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpb02044]
    RPB_2732
Secretion system [BR:rpb02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   RPB_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF MMPL Sec_GG SecD-TM1 ACR_tran Caveolin
Motif
Other DBs
NCBI-ProteinID: ABD07434
UniProt: Q2IWH6
Position
complement(3115572..3117173)
Genome map
AA seq 533 aa AA seqDB search
MLYFTRWKALAVIVTALAVCLCAVPNFFPDHTVKTWPKWAQRHLVLGLDLQGGSHILLEV
DANSVRKDKLDSVRDDARRVLREARIAYTGLATKGDQVEVRISKENEVPTALTKLRELSQ
PLGGLLGSNGQRSLDVTDAGGGLIRLTVPQAAIAERVRQSVDQSIQIVERRVNELGTVEP
LIQRQGADRILVQVPGLQDPTRLKELLGKTAKLDFRMVDSSVSPEQAQAGRAPSDSDVLM
SSSSPKQPYVIKKQVLVSGADLTDAQPGFDQRTSEPIVSFRFNTNGARKFARATTENVGQ
PFAIVLDNEVISAPVIREPITGGSGQISGSFTVQGANDLAILLRAGALPAPLTIIEERTV
GPGLGQDSIEKGELAAYVGSILVIIFMLLTYRLFGVFANIAVAVNVAMIFGVLSLLNATL
TLPGIAGVVLTVGIAVDSNVLIYERIREELRAGRNAISAIDAGFKRALSTILDSNITTFI
AAAVLFYIGTGPVRGFAVTLGIGIITTVFTAFTVTRLIVATWVRWKRPQTVPI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatttcacacggtggaaggcgctggcggtcattgtgacggcgctggcggtgtgc
ctttgcgccgttcccaacttcttccccgaccacaccgtgaagacctggccgaaatgggcg
cagcgccatctggtgctgggcctcgacctgcagggcggctcgcacatcctgctcgaggtc
gacgccaattcggtgaggaaggacaagctcgattcggtgcgcgacgatgcgcgccgggtg
ctgcgcgaagcccggatcgcctatacgggtctggcgacgaagggcgaccaggtcgaggtt
cggatcagcaaggagaacgaggtcccgaccgcgctcaccaagctgcgtgagctgtcgcag
ccgctcggtggcttgctcggcagcaacggccagcgcagcctcgacgtcaccgatgccggt
ggcggcttgatccggctgaccgtgccgcaggcggcgatcgccgaacgggtgcgccagtcg
gtcgaccagtcgatccagatcgtcgagcgccgcgtcaacgaactcggcaccgtcgagccg
ctgatccagcgtcagggcgccgatcggattctcgtccaggtgcccggtctgcaggatccg
acccgattgaaggaactgctcggcaagacagccaagctcgacttccgcatggtggattcc
tcggtgtcgcccgaacaggcgcaagcgggccgcgcgccgtcggattccgatgtgctgatg
agttcgtcgtcgccgaagcagccttacgtcatcaagaagcaggtgctggtgtccggcgcc
gatctcaccgacgcgcagccgggcttcgaccagcgcaccagcgagccgatcgtcagcttc
cgcttcaacaccaacggcgcccgcaaattcgcccgcgccaccaccgagaatgtcggccaa
ccgttcgcgatcgtgctcgacaacgaggtgatctccgcgcccgtgatccgtgagccgatc
accggcggctccggccagatttccggcagcttcaccgtgcagggcgccaacgatctcgcg
atcctgctgcgcgccggcgcgctgccggcgccgctgacgatcatcgaggaacgcaccgtc
ggccccggcctcggccaggattcgatcgagaagggcgaactcgcggcctatgtcggctcg
atcctcgtcatcatcttcatgctgctgacctaccggctgttcggcgtgttcgccaacatc
gcggtggccgtcaacgtggcgatgatcttcggcgtgctgtcgctgctcaacgccacgctg
acgctgcccggcatcgccggcgtggtgctcaccgtcggcatcgcggtggactccaacgtg
ctgatctacgagcgcatccgcgaggagctgcgcgccggccgcaatgcgatctcggcgatc
gatgccggcttcaagcgggcgctgtcgacgattctcgattccaacatcaccaccttcatc
gccgccgcggtgctgttctacatcggcaccgggccggtgcgcggcttcgcggtgacgctc
ggcatcggcattatcaccaccgtgttcaccgccttcaccgtgacccggctgatcgttgcc
acctgggtgcggtggaagcggccgcagaccgtgccgatctga

DBGET integrated database retrieval system