KEGG   Rhodopseudomonas palustris HaA2: RPB_2733Help
Entry
RPB_2733          CDS       T00321                                 

Definition
(GenBank) protein translocase subunit yajC
  KO
K03210  preprotein translocase subunit YajC
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb02024  Quorum sensing
rpb03060  Protein export
rpb03070  Bacterial secretion system
Module
rpb_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    RPB_2733
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    RPB_2733
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RPB_2733
Secretion system [BR:rpb02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   RPB_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78
Motif
Other DBs
NCBI-ProteinID: ABD07435
UniProt: Q2IWH5
Position
complement(3117216..3117644)
Genome map
AA seq 142 aa AA seqDB search
MFVTPAFAQAAAAGGDANSMLMSLLPFALIFVIMYFLILRPQQRKVKEHAELVKNIRRGD
TIITSGGLVGKVTKVVDDDQIEFELADGVRARQMRQMITGVRTKGEPVKDVPEKGKGKSK
DKDADDKAESAKDSTKDDTASS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttactcctgcatttgctcaggccgcggccgccggcggcgacgccaacagcatg
ctgatgtcgctgctgccgttcgcgctgatcttcgtcatcatgtatttcctgatcctgcgg
ccgcagcagcgcaaggtgaaggagcacgccgaactggtgaagaacatccgccgcggcgac
accatcatcacctcgggcggcctggtcggcaaggtgaccaaggtggtcgacgacgaccag
atcgagttcgaactcgccgacggtgtccgcgcgcgccagatgcgccagatgatcaccggc
gtccgcaccaagggcgagccggtcaaggacgttcccgagaagggcaagggcaagtccaag
gacaaggacgccgacgacaaggccgaatcggccaaggactcgaccaaggacgacaccgcg
tcgagctga

DBGET integrated database retrieval system